Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA79261_AD13.jpg Application Data

VEGF120 active protein

Mouse VEGF120

Gene Names
Vegfa; Vpf; Vegf
Reactivity
Mouse
Purity
> 95% by SDS-PAGE & silver stain
Synonyms
VEGF120; N/A; Mouse VEGF120; Recombinant Mouse Vascular Endothelial Growth Factor120; VEGF-A; VPF; VEGF120 active protein
Ordering
Host
E Coli
Reactivity
Mouse
Purity/Purification
> 95% by SDS-PAGE & silver stain
Form/Format
Lyophilized
Sequence
APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSC VPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSR CECRPKKDRTKPEKCDKPRR
Sequence Length
120
Endotoxin Level
< 0.1ng per ug of mouse VEGF120
Buffer
50 mM acetic acid
Preparation and Storage
Lyophilized samples are stable for greater than six months at -20 degree C to -70 degree C. Reconstituted VEGF120 should be stored in working aliquots at -20 degree C.

Application Data

product-image-AAA79261_AD13.jpg Application Data

Application Data

product-image-AAA79261_AD15.jpg Application Data
Related Product Information for VEGF120 active protein
Mouse Vascular Endothelial Growth Factor120 (VEGF120), a 14.1 kDa protein consisting of 120 amino acid residues, is produced as a homodimer. VEGF120 is a polypeptide growth factor and a member of the platelet-derived growth factor family. It is a specific mitogen for vascular endothelial cells and a strong angiogenic factor in vivo. Two high-affinity tyrosine kinase receptors for VEGF120 have been identified, VEGFR-1 (FLT-1), and VEGFR-2 (Flk-1). Consistent with the endothelial cell-specific action of VEGF120, expression of both receptor genes has been found predominantly but not exclusively on endothelial cells. Expression of VEGFR-1 was also found on human monocytes, neutrophils (PMNs), bovine brain pericytes and villous and extravillous trophoblasts. In addition to its action as a mitogen it is a potent vascular permeability factor (VPF) in vivo and is also a chemo attractant for monocytes and endothelial cells. At least four different proteins are generated by differential splicing of the mouse VEGF gene: VEGF120, VEGF144, VEGF164 and VEGF188. The most abundant form is VEGF164. Whereas VEGF120, VEGF144 and VEGF164 are secreted proteins, VEGF188 is strongly cell-associated. In addition, the isoforms VEGF164 and VEGF188 bind to heparin with high affinity. VEGF is apparently a homodimer, but preparations of VEGF show some heterogeneity on SDS gels depending of the secretion of different forms and the varying degrees of glycosylation. All dimeric forms possess similar biological activities. There is evidence that heterodimeric molecules between the different isoforms exists and that different cells and tissues express different VEGF isoforms. A related protein of VEGF is placenta growth factor (PlGF) with about 53% homology and VEGF-B with similar biological activities.
Product Categories/Family for VEGF120 active protein
References
1. Breier et al., Dev 114:521, 1992 2. Fiebig et al., Eur J Biochem 211:19, 1993 3. Flamme et al., Dev Biol 162:699, 1995 4. Kremer at al., Cancer Res 57:3852, 1997

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,283 Da
NCBI Official Full Name
vascular endothelial growth factor A isoform 1
NCBI Official Synonym Full Names
vascular endothelial growth factor A
NCBI Official Symbol
Vegfa
NCBI Official Synonym Symbols
Vpf; Vegf
NCBI Protein Information
vascular endothelial growth factor A; vascular permeability factor
UniProt Protein Name
Vascular endothelial growth factor A
UniProt Gene Name
Vegfa
UniProt Synonym Gene Names
Vegf; VEGF-A; VPF
UniProt Entry Name
VEGFA_MOUSE

Similar Products

Product Notes

The VEGF120 vegfa (Catalog #AAA79261) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The Mouse VEGF120 reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: APTTEGEQKS HEVIKFMDVY QRSYCRPIET LVDIFQEYPD EIEYIFKPSC VPLMRCAGCC NDEALECVPT SESNITMQIM RIKPHQSQHI GEMSFLQHSR CECRPKKDRT KPEKCDKPRR. It is sometimes possible for the material contained within the vial of "VEGF120, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.