Host
E coli
Form/Format
Purified protein solution after extensive dialysis against PBS, pH 8.0
Sequence
AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Accession #:
P09038
Accession #:
P09038
Species
Human
Tag
His
Expression System
Fibroblast growth factor 2 (FGF-2), produced in E coli is a single non-glycosylated polypeptide chain containing 154 amino acids. A fully biologically active molecule has a molecular mass of 17.1 kDa. The apparent molecular mass of the protein is approximately 20 kD analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
Preparation and Storage
This product is stable for one year upon receipt, when handled and stored as instructed. Upon reconstitution, protein aliquots should be stored at -20 degree C or -80 degree C. Avoid repeated freeze/thaw cycles.
Related Product Information for FGF-2 protein
FGF-2, also known as a basic fibroblast growth factor (bFGF),is a growth factor and signaling protein encoded by the FGF-2 gene. FGF-2 has been shown in preliminary animal studies to protect the heart from injury associated with a heart attack, reducing tissue death and promoting improved function after reperfusion. FGF-2 are also involved in a variety of biological processes, including embryonic development, morphogenesis, tissue repair, tumor growth, and invasion
Product Categories/Family for FGF-2 protein
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The FGF-2 (Catalog #AAA269809) is a Protein produced from E coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: AAGSITTLPA LPEDGGSGAF PPGHFKDPKR LYCKNGGFFL RIHPDGRVDG VREKSDPHIK LQLQAEERGV VSIKGVCANR YLAMKEDGRL LASKCVTDEC FFFERLESNN YNTYRSRKYT SWYVALKRTG QYKLGSKTGP GQKAILFLPM SAKS Ac cession #: P0 9038. It is sometimes possible for the material contained within the vial of "FGF-2, Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
