NFKB2/P52 protein

NFKB2/P52 (His tag)

Cat. Num. AAA269813

• Synonyms: NFKB2/P52; N/A; NFKB2/P52 (His tag); CVID10;DNA binding factor KBF2;H2TF1;Lymphocyte translocation chromosome 10; Lyt 10;NFKB2; NFKB2_HUMAN; Nuclear factor NF kappa B p100 subunit; Nuclear factor NF kappa B p52 subunit; Nuclear factor of kappa light chain gene enhancer in B cells 2; Nuclear factor of kappa light polypeptide gene enhancer in B cells 2; Oncogene Lyt 10; p105; p49/p100; NFKB2/P52 protein

• Host: E coli
• Form/Format: Purified protein solution after extensive dialysis against PBS, pH 7.4.
• Sequence: NEEPLCPLPSPPTSDSDSDSEGPEKDTRSSFRGHTPLDLTCSTKVKTLLLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTAEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH; Accession #: ; Q00653.4

• Species: Human
• Tag: His
• Expression System: NF-kappa-B, produced in E coli is a single non-glycosylated polypeptide chain containing 203 amino acids. A fully biologically active molecule has a molecular mass of 21.4 kDa. The apparent molecular mass of the protein is approximately 27 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
• Preparation and Storage: For long term storage, the product should be stored at -20 degree C or lower. Please avoid repeated freeze-thaw cycles.

SDS-PAGE

(SDS-PAGE of p52 (#AAA269813).)

Application Data

Related Product Information for NFKB2/P52 protein

NF-kappa-B is a pleiotropic transcription factor which is present in almost all cell types and is involved in many biological processed such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NF-kappa-B is a homo-or heterodimeric complex formed by the Rel- like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52. The dimers bind at kappa-B sites in the DNA of their target genes and the individual dimers have distinct preferences for different kappa-B sites that they can bind with distinguishable affinity and specificity. Different dimer combinations act as transcriptional activators or repressors, respectively. NF-kappa-B is controlled by various mechanisms of post-translational modification and subcellular compartmentalization as well as by interactions with other cofactors or corepressors.NF-kappa-B complexes are held in the cytoplasm in an inactive state complexed with members of the NF-kappa-B inhibitor (I-kappa-B) family. In a conventional activation pathway, I-kappa-B is phosphorylated by I-kappa-B kinases (IKKs) in response to different activators, subsequently degraded thus liberating the active NF-kappa-B complex which translocates to the nucleus. In a non-canonical activation pathway, the MAP3K14-activated CHUK/IKKA homodimer phosphorylates NFKB2/p100 associated with RelB, inducing its proteolytic processing to NFKB2/p52 and the formation of NF-kappa-B RelB-p52 complexes. The NF-kappa-B heterodimeric RelB-p52 complex is a transcriptional activator. The NF-kappa-B p52-p52 homodimer is a transcriptional repressor. NFKB2 appears to have dual functions such as cytoplasmic retention of attached NF-kappa-B proteins by p100 and generation of p52 by a cotranslational processing.The proteasome-mediated process ensures the production of both p52 and p100 and preserves their independent function. p52 binds to the kappa-B consensus sequence 5'-GGRNNYYCC-3', located in the enhancer region of genes involved in immune response and acute phase reactions. p52 and p100 are respectively the minor and major form; the processing of p100 being relatively poor. Isoform p49 is a subunit of the NF-kappa-B protein complex, which stimulates the HIV enhancer in synergy with p65

Product Categories/Family for NFKB2/P52 protein

Protein & Antigen