Host
E coli
Form/Format
Purified protein solution after extensive dialysis against PBS, pH 8.5
Sequence
MAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Accession #:
P15692-4
Accession #:
P15692-4
Species
Human
Tag
His
Expression System
Vascular endothelial growth factor (VEGF), produced in E coli is a single non-glycosylated polypeptide chain containing 165 amino acids. A fully biologically active molecule has a molecular mass of 19.2 kDa. The apparent molecular mass of the protein is approximately 22kD analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
Preparation and Storage
For long term storage, the product should be stored at -20 degree C or lower. Please avoid repeated freeze-thaw cycles.
Related Product Information for VEGF-165 protein
VEGF165 is the most abundant splice variant of VEGF-A. VEGF165 is produced by a number of cells including endothelial cells, macrophages and T cells. VEGF165 is involved in angiogenesis, vascular endothelial cell survival, growth, migration and vascular permeability. VEGF gene expression is induced by hypoxia, inflammatory cytokines and oncogenes. VEGF165 binds to heparan sulfate and is retained on the cell surface and in the extracellular matrix. VEGF165 binds to the receptor tyrosine kinases, VEGFR1 and VEGFR2. VEGF165 is the only splice variant that binds to co-receptors NRP-1 and NRP-2 that function to enhance VEGFR2 signaling. Binding of VEGF165 to VEGFR1 and VEGFR2 leads to activation of the PI3K/AKT, p38 MAPK, FAK and paxillin. VEGF plays a key role in tumor angiogenesis in many cancers
Product Categories/Family for VEGF-165 protein
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The VEGF-165 (Catalog #AAA269810) is a Protein produced from E coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MAPMAEGGGQ NHHEVVKFMD VYQRSYCHPI ETLVDIFQEY PDEIEYIFKP SCVPLMRCGG CCNDEGLECV PTEESNITMQ IMRIKPHQGQ HIGEMSFLQH NKCECRPKKD RARQENPCGP CSERRKHLFV QDPQTCKCSC KNTDSRCKAR QLELNERTCR CDKPRR Accession #: P1 5692-4. It is sometimes possible for the material contained within the vial of "VEGF-165, Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
