Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA196546_SDS_PAGE15.jpg SDS-PAGE (12% SDS-PAGE:)

Serum amyloid A Protein | SAA1 protein

Serum amyloid A protein

Average rating 0.0
No ratings yet
Gene Names
SAA2; SAA; SAA1
Applications
Western Blot, ELISA
Purity
>90%
Synonyms
Serum amyloid A; N/A; Serum amyloid A protein; SAA; SAA1 protein
Ordering
Host
E. coli
Purity/Purification
>90%
Form/Format
50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole,10%glycerol(PH8.0)
Concentration
1mg/mL (varies by lot)
Sequence
EGAKDMWRAYSDMREANYKGADKYFHARGNYDAAQRGPGGAWAAKVISDARENIQRFTDPLFKGTTSGQGQEDSRADQAANEWGRSGKDPNHFRPAGLPDKY
Applicable Applications for SAA1 protein
WB (Western Blot), ELISA
Specification
1mg/mL;0.1mg
Organism
Bos taurus (Bovine)
Preparation and Storage
Store at -20°C. (Avoid repeated freezing and thawing.)

SDS-PAGE

(12% SDS-PAGE:)

product-image-AAA196546_SDS_PAGE15.jpg SDS-PAGE (12% SDS-PAGE:)
Related Product Information for SAA1 protein
Recombinant protein with His-tag

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11.22KD
NCBI Official Full Name
serum amyloid A protein
NCBI Official Symbol
SAA2
NCBI Official Synonym Symbols
SAA; SAA1
NCBI Protein Information
serum amyloid A protein
UniProt Protein Name
Serum amyloid A protein
UniProt Gene Name
SAA1
UniProt Synonym Gene Names
SAA; SAA

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SAA1 saa1 (Catalog #AAA196546) is a Protein produced from E. coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Serum amyloid A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ELISA. Researchers should empirically determine the suitability of the SAA1 saa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EGAKDMWRAY SDMREANYKG ADKYFHARGN YDAAQRGPGG AWAAKVISDA RENIQRFTDP LFKGTTSGQG QEDSRADQAA NEWGRSGKDP NHFRPAGLPD KY. It is sometimes possible for the material contained within the vial of "Serum amyloid A, Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.