VEGF-F (Bothrops insularis) Active Protein | VEGF-F active protein
Snake VEGF-F (Bothrops insularis)
Reactivity
Snake
Purity
> 95% by SDS-PAGE & silver stain
Synonyms
VEGF-F (Bothrops insularis); N/A; Snake VEGF-F (Bothrops insularis); Recombinant Snake Venom Vascular Endothelial Growth Factor-F; svVEGF; VEGF-F; VEGF-F active protein
Host
E Coli
Reactivity
Snake
Purity/Purification
> 95% by SDS-PAGE & silver stain
Form/Format
Lyophilized
Sequence
MGQVMPFMEVYRHSVCQTRETLVSILEEHPDEVSHIFRPSCVTALRCGGCCTDESLKCTATGKRSVGREIMRVDPHKGTSKTEVMQFTEHTDCECRPRSASGVNSRKHKRNPEEGEPRAKFPFV
Sequence Length
124
Endotoxin Level
=0.13 ng per ug of sv-VEGF-F
Biological Activity
Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) and human dermal lymphatic endothelial cells (HDLEC) using a concentration range of 2-50 ng/ml.
Buffer
50 mM acidic acid
Stabilizer
None
Reconstitution
The lyophilized svVEGF-F should be reconstituted in water or medium to a concentration not lower than 50 ?g/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin.
Preparation and Storage
Lyophilized samples are stable for greater than six months at -20 degree C to -70 degree C. Reconstituted svVEGF-F should be stored in working aliquots at -20 degree C. Avoid repeated freeze-thaw cycles!
Related Product Information for VEGF-F active protein
Vascular endothelial growth factor (VEGF-A) and its family proteins are crucial regulators of blood vessel formation and vascular permeability. Snake venom has recently been shown to be an exogenous source of unique VEGF (known as VEGF-F), and now, two types of VEGF-F with distinct biochemical properties have been reported. VEGF-Fs (venom type VEGFs) are highly variable in structure and function among species, in contrast to endogenous tissue-type VEGFs (VEGF-As) of snakes. Although the structures of tissue-type VEGFs are highly conserved among venomous snake species and even among all vertebrates, including humans, those of venom-type VEGFs are extensively variegated, especially in the regions around receptor-binding loops and C-terminal putative coreceptor-binding regions, indicating that highly frequent variations are located around functionally key regions of the proteins. Genetic analyses suggest that venom-type VEGF gene may have developed from a tissue-type gene and that the unique sequence of its C-terminal region was generated by an alteration in the translation frame in the corresponding exons. The svVEGF-F was identified during the generation of abundant expressed sequence tags from the Viperidae snake Bothrops insularis venom glands. The deduced primary sequence, after complete sequencing of the longest snake venom VEGF (svVEGF) cDNA, displayed similarity with vertebrate VEGFs and with the hypotensive factor from Vipera aspis venom. The mature svVEGF appears to be ubiquitously distributed throughout snake venoms and was also confirmed by Northern blot studies of other related Viperidae species and by cDNA cloning of svVEGF from Bothrops jararaca pit viper. The produced recombinant protein dimerizes after refolding processes and was biologically characterized, showing ability to increase vascular permeability. These results established that svVEGF is a novel and important active toxin during the early stages of bothropic snake bite envenoming and represents a new member of the VEGF family of proteins.
Product Categories/Family for VEGF-F active protein
References
1. Junqueira de Azevedo et al, JBC 276, 2001 2. Gasmi et al, JBC 276, 2002 3. Yamazaki et al, JBC 278, 2003 4. Takahashi et al, JBC 279, 2004 5. Yamazaki et al, JBC 280, 2005 6. Yamazaki et al, JBC 284, 2009
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
27,6 kDa (Dimer)
NCBI Official Full Name
Snake venom vascular endothelial growth factor toxin
UniProt Protein Name
Snake venom vascular endothelial growth factor toxin
UniProt Gene Name
svVEGF
UniProt Synonym Gene Names
svVEGF
UniProt Entry Name
TXVE_BOTIN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The VEGF-F svvegf (Catalog #AAA79229) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The Snake VEGF-F (Bothrops insularis) reacts with Snake and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: MGQVMPFMEV YRHSVCQTRE TLVSILEEHP DEVSHIFRPS CVTALRCGGC CTDESLKCTA TGKRSVGREI MRVDPHKGTS KTEVMQFTEH TDCECRPRSA SGVNSRKHKR NPEEGEPRAK FPFV. It is sometimes possible for the material contained within the vial of "VEGF-F (Bothrops insularis), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
