Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA13742_APP.jpg Application Data (SDS-PAGE(12%): purified E2 (HCV)(aa 383-663), subtype 1b)

E2 (HCV) Recombinant Protein | E2 recombinant protein

E2 (HCV) (amino acid 383-663), subtype 1b

Applications
Western Blot, ELISA
Purity
> = 96% purity
Synonyms
E2 (HCV); N/A; E2 (HCV) (amino acid 383-663), subtype 1b; HCV E2 protein; subtype 1b; Subtype 1b; Hepatitis C Virus E2 Recombinant Protein; E2 recombinant protein
Ordering
Specificity
>95% Purity
Purity/Purification
> = 96% purity
Concentration
1ug/uL in PBS (varies by lot)
Sequence
GQTRAVGGMQSHFTQRFVSLFSLGPAQKIQLVNTNGSWHVNRTALNCNDSLQTGFIAALFYANRFNSSGCPERLASCRPIDKFAQGWGPITYAKPDSPDQRPYCWHYAPQPCGIVPASEVCGPVYCFPSPVVVGTPIRFGVPTYTWGANETDVLLLNNTRPPLGNWFGCTWMNATGFTKTCGGPPCNIGGVGNNALTCPTDCFRKHPEATYAKCGSGPWLTPRCMVDYPYRLWHYPCTVNFTIFKVRMYVGGVERLNAACNWTRGERCNLEDRDRSELS
Sequence Length
9577
Applicable Applications for E2 recombinant protein
WB (Western Blot), ELISA, Antigen
Viral Protein
C-terminal 6xHis tagged HCV E2 protein (amino acid 383-663)(subtype 1b)(Genebank No. AY460204)
Endotoxin Level
<0.01 EU per 1 ug of the protein by LAL test
Preparation and Storage
Store at -20°C. Stable for 6-months from the date of shipment when kept at 4°C. Non-hazardous. No MSDS required.

Application Data

(SDS-PAGE(12%): purified E2 (HCV)(aa 383-663), subtype 1b)

product-image-AAA13742_APP.jpg Application Data (SDS-PAGE(12%): purified E2 (HCV)(aa 383-663), subtype 1b)
Related Product Information for E2 recombinant protein
Viral protein purified from 293 cell culture.

The hepatitis C virus (HCV) is a small, enveloped, single-stranded, positive-sense RNA virus. HCV has a high rate of replication with approximately one trillion particles produced ach day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. There are seven major genotypes of HCV with several subtypes within each genotype.

The viral RNA codes for a large polyprotein of approx. 3100 amino acids, which is posttranslationally processed by cellular and viral proteases. The N-terminus encompasses the structural proteins core andtwo glycoproteins (E1,E2);the C-terminus encompasses the p7 protein and the nonstructural (NS) proteins NS2, NS3, NS4A, NS4B, NS5A and NS5B.
Product Categories/Family for E2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI Official Full Name
Hepatitis C virus from Shanghai, complete genome
UniProt Protein Name
Genome polyprotein
UniProt Entry Name
Q6SCJ5_9HEPC

Similar Products

Product Notes

The E2 (Catalog #AAA13742) is a Recombinant Protein and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's E2 (HCV) can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ELISA, Antigen. Researchers should empirically determine the suitability of the E2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GQTRAVGGMQ SHFTQRFVSL FSLGPAQKIQ LVNTNGSWHV NRTALNCNDS LQTGFIAALF YANRFNSSGC PERLASCRPI DKFAQGWGPI TYAKPDSPDQ RPYCWHYAPQ PCGIVPASEV CGPVYCFPSP VVVGTPIRFG VPTYTWGANE TDVLLLNNTR PPLGNWFGCT WMNATGFTKT CGGPPCNIGG VGNNALTCPT DCFRKHPEAT YAKCGSGPWL TPRCMVDYPY RLWHYPCTVN FTIFKVRMYV GGVERLNAAC NWTRGERCNL EDRDRSELS. It is sometimes possible for the material contained within the vial of "E2 (HCV), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.