Papillomavirus type 16 Protein E6 (E6) Recombinant Protein | E6 recombinant protein
Recombinant Human papillomavirus type 16 Protein E6 (E6)
Purity
                                                    Greater or equal to 85% purity as determined by SDS-PAGE.
                                                Synonyms
                                            Papillomavirus type 16 Protein E6 (E6); N/A; Recombinant Human papillomavirus type 16 Protein E6 (E6); E6 recombinant protein
                                        
                    Host                
                
                    E Coli or Yeast or Baculovirus or Mammalian Cell                
            
                    Purity/Purification                
                
                    Greater or equal to 85% purity as determined by SDS-PAGE.                
            
                    Form/Format                
                
                    Lyophilized or liquid (Format to be determined during the manufacturing process)                
            
                    Sequence Positions                
                
                    1-158aa; Full Length of Mature Protein                
            
                    Sequence                
                
                    MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL
                
            
                    Preparation and Storage                
                
                    Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.                
            
                    Related Product Information for E6 recombinant protein                
                
                 
                    Plays a major role in the induction and maintenance of cellular transformation. Acts mainly as an oncoprotein by stimulating the destruction of many host cell key regulatory proteins. E6 associates with host E6-AP ubiquitin-protein ligase, and inactivates tumor suppressors TP53 and TP73 by targeting th to the 26S proteasome for degradation. In turn, DNA damage and chromosomal instabilities increase and lead to cell proliferation and cancer development. The complex E6/E6P targets several other substrates to degradation via the proteasome including host NFX1-91, a repressor of human telomerase reverse transcriptase (hTERT). The resulting increased expression of hTERT prevents the shortening of telomere length leading to cell immortalization. Other cellular targets including Bak, Fas-associated death domain-containing protein (FADD) and procaspase 8, are degraded by E6/E6AP causing inhibition of apoptosis. E6 also inhibits immune response by interacting with host IRF3 and TYK2. These interactions prevent IRF3 transcriptional activities and inhibit TYK2-mediated JAK-STAT activation by interferon alpha resulting in inhibition of the interferon signaling pathway.                 
                
            
                    Product Categories/Family for E6 recombinant protein                
                
            
                    References                
                
                    Human papillomavirus type 16 DNA sequence.Seedorf K., Krammer G., Durst M., Suhai S., Rowekamp W.G.Virology 145:181-185(1985)
 Cloning and sequencing of non-European human papillomavirus (HPV)variant complete genomes from cervicovaginal cells by an overlapping PCR method.Terai M., Fu L., Ma Z., Burk R.D. Expression of the human papillomavirus type 16 genome in SK-v cells, a line derived from a vulvar intraepithelial neoplasia.Schneider-Maunoury S., Pehau-Arnaudet G., Breitburd F., Orth G.J. Gen. Virol. 71:809-817(1990)
 Telomerase activation by the E6 gene product of human papillomavirus type 16.Klingelhutz A.J., Foster S.A., McDougall J.K.Nature 380:79-82(1996)
 Human papillomavirus 16 E6 oncoprotein binds to interferon regulatory factor-3 and inhibits its transcriptional activity.Ronco L.V., Karpova A.Y., Vidal M., Howley P.M.Genes Dev. 12:2061-2072(1998)
 The human papilloma virus (HPV)-18 E6 oncoprotein physically associates with Tyk2 and impairs Jak-STAT activation by interferon-alpha.Li S., Labrecque S., Gauzzi M.C., Cuddihy A.R., Wong A.H., Pellegrini S., Matlashewski G.J., Koromilas A.E.Oncogene 18:5727-5737(1999)
 Interaction of oncogenic papillomavirus E6 proteins with fibulin-1.Du M., Fan X., Hong E., Chen J.J.Biochem. Biophys. Res. Commun. 296:962-969(2002)
 Identification of a novel telomerase repressor that interacts with the human papillomavirus type-16 E6/E6-AP complex.Gewin L., Myers H., Kiyono T., Galloway D.A.Genes Dev. 18:2269-2282(2004)
 Oncogenic human papillomavirus E6 proteins target the MAGI-2 and MAGI-3 proteins for degradation.Thomas M., Laura R., Hepner K., Guccione E., Sawyers C., Lasky L., Banks L.Oncogene 21:5088-5096(2002)
 Role of the PDZ domain-binding motif of the oncoprotein E6 in the pathogenesis of human papillomavirus type 31.Lee C., Laimins L.A.J. Virol. 78:12366-12377(2004)
 HPV E6 specifically targets different cellular pools of its PDZ domain-containing tumour suppressor substrates for proteasome-mediated degradation.Massimi P., Gammoh N., Thomas M., Banks L.Oncogene 23:8033-8039(2004)
 Cellular and molecular biological aspects of cervical intraepithelial neoplasia.Kisseljov F., Sakharova O., Kondratjeva T.Int. Rev. Cytol. 271:35-95(2008)
                
            NCBI and Uniprot Product Information
                    NCBI GI #                
                
            
                    NCBI GeneID                
                
            
                    NCBI Accession #                
                
            
                    NCBI GenBank Nucleotide #                
                
            
                    Molecular Weight                
                
                                            21.2 kDa                                    
            
                    NCBI Official Full Name                
                
                    transforming protein                
            
                    NCBI Official Symbol                
                
                    E6                 
            
                    NCBI Protein Information                
                
                    transforming protein                
            
                    UniProt Protein Name                
                
                    Protein E6                
            
                    UniProt Gene Name                
                
                    E6                
            
                    UniProt Entry Name                
                
                    VE6_HPV16                
            Similar Products
Product Notes
The E6 e6 (Catalog #AAA18671) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-158aa; Full Length of Mature Protein. The amino acid sequence is listed below: MHQKRTAMFQ DPQERPRKLP QLCTELQTTI HDIILECVYC KQQLLRREVY DFAFRDLCIV YRDGNPYAVC DKCLKFYSKI SEYRHYCYSL YGTTLEQQYN KPLCDLLIRC INCQKPLCPE EKQRHLDKKQ RFHNIRGRWT GRCMSCCRSS RTRRETQL . It is sometimes possible for the material contained within the vial of "Papillomavirus type 16 Protein E6 (E6), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.

 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                