E7 Protein of Human Papillomavirus (HPV) 16 Recombinant Protein
Recombinant E7 Protein of Human Papillomavirus (HPV) 16
Applications
ELISA, Western Blot
Synonyms
E7 Protein of Human Papillomavirus (HPV) 16; N/A; Recombinant E7 Protein of Human Papillomavirus (HPV) 16; E7 Protein of Human Papillomavirus (HPV) 16 recombinant protein
Host
E.coli
Specificity
> 80% purity
Concentration
50 ug (1 ug/ul) in PBS pH7.4 (varies by lot)
Sequence
MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKPHHHHHH
Applicable Applications for E7 Protein of Human Papillomavirus (HPV) 16 recombinant protein
ELISA, WB (Western Blot)
Viral Protein
C-terminal his-tagged full-length E7 recombinant protein of human papillomavirus 16 (GenBank accession#: AAA46940)
Endotoxin Level
<0.01 EU per 1 ug of the protein by LAL test
Preparation and Storage
Store at -20 degree C; Stable for 3-months from the date of receipt when kept at 4 degree C.
Related Product Information for E7 Protein of Human Papillomavirus (HPV) 16 recombinant protein
Description:
Recombinant protein expressed and purified from E.coli
Introduction:
The human papillomavirus (HPV) is a non-enveloped, double-stranded, circular DNA (7-8 kb) virus that is responsible for causing multiple epithelial lesions and cancers. Papillomavirus genome is divided into an early region (E), encoding eight functional early (E-E8) that are expressed immediately after initial infection of a host cell, and a late region (L) encoding a major capsid protein L1 and a minor capsid protein L2. Papillomaviruses are non-enveloped, and its outer shell is mainly composed by capsid protein L1.
Recombinant protein expressed and purified from E.coli
Introduction:
The human papillomavirus (HPV) is a non-enveloped, double-stranded, circular DNA (7-8 kb) virus that is responsible for causing multiple epithelial lesions and cancers. Papillomavirus genome is divided into an early region (E), encoding eight functional early (E-E8) that are expressed immediately after initial infection of a host cell, and a late region (L) encoding a major capsid protein L1 and a minor capsid protein L2. Papillomaviruses are non-enveloped, and its outer shell is mainly composed by capsid protein L1.
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The E7 Protein of Human Papillomavirus (HPV) 16 (Catalog #AAA62268) is a Recombinant Protein produced from E.coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's E7 Protein of Human Papillomavirus (HPV) 16 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the E7 Protein of Human Papillomavirus (HPV) 16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MHGDTPTLHE YMLDLQPETT DLYCYEQLND SSEEEDEIDG PAGQAEPDRA HYNIVTFCCK CDSTLRLCVQ STHVDIRTLE DLLMGTLGIV CPICSQKPHH HHHH. It is sometimes possible for the material contained within the vial of "E7 Protein of Human Papillomavirus (HPV) 16, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
