Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Early growth response protein 1 Recombinant Protein | EGR1 recombinant protein

Recombinant Human Early growth response protein 1

Gene Names
EGR1; TIS8; AT225; G0S30; NGFI-A; ZNF225; KROX-24; ZIF-268
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Early growth response protein 1; N/A; Recombinant Human Early growth response protein 1; AT225Nerve growth factor-induced protein A; NGFI-ATranscription factor ETR103Transcription factor Zif268Zinc finger protein 225Zinc finger protein Krox-24; EGR1 recombinant protein
Ordering
Host
Yeast
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Tris-based buffer 50% glycerol
Sequence Positions
Expression Region: 444-543. Sequence Info:Partial
Sequence
SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSS AVTNSFSASTGLSDMTATFSPRTIEIC
Sequence Length
543
Calculated MW
12.1 kDa
Tag Info
N-terminal 6xHis-tagged
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.

Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Related Product Information for EGR1 recombinant protein
Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-CGCCCCCGC-3' (EGR-site). Activates the transcription of target genes whose products are required for mitogenesis and differentiation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
early growth response protein 1
NCBI Official Synonym Full Names
early growth response 1
NCBI Official Symbol
EGR1
NCBI Official Synonym Symbols
TIS8; AT225; G0S30; NGFI-A; ZNF225; KROX-24; ZIF-268
NCBI Protein Information
early growth response protein 1
UniProt Protein Name
Early growth response protein 1
UniProt Gene Name
EGR1
UniProt Synonym Gene Names
; NGFI-A

Similar Products

Product Notes

The EGR1 egr1 (Catalog #AAA309774) is a Recombinant Protein produced from Yeast and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Expression Region: 444-543. Sequence Info:Partial. The amino acid sequence is listed below: SPVATSYPSP VTTSYPSPAT TSYPSPVPTS FSSPGSSTYP SPVHSGFPSP SVATTYSSVP PAFPAQVSSF PSS AVTNSFSAST GLSDMTATFS PRTIEIC. It is sometimes possible for the material contained within the vial of "Early growth response protein 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.