Eukaryotic translation initiation factor 5B (EIF5B) Recombinant Protein | EIF5B recombinant protein
Recombinant Human Eukaryotic translation initiation factor 5B (EIF5B) , partial
Gene Names
EIF5B; IF2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Eukaryotic translation initiation factor 5B (EIF5B); N/A; Recombinant Human Eukaryotic translation initiation factor 5B (EIF5B) , partial; EIF5B recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
629-846aa; partial
Sequence
LRAPIICVLGHVDTGKTKILDKLRHTHVQDGEAGGITQQIGATNVPLEAINEQTKMIKNFDRENVRIPGMLIIDTPGHESFSNLRNRGSSLCDIAILVVDIMHGLEPQTIESINLLKSKKCPFIVALNKIDRLYDWKKSPDSDVAATLKKQKKNTKDEFEERAKAIIVEFAQQGLNAALFYENKDPRTFVSLVPTSAHTGDGMGSLIYLLVELTQTML
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for EIF5B recombinant protein
Accurate initiation of translation in eukaryotes is complex and requires many factors, some of which are composed of multiple subunits. The process is simpler in prokaryotes which have only three initiation factors (IF1, IF2, IF3). Two of these factors are conserved in eukaryotes: the homolog of IF1 is eIF1A and the homolog of IF2 is eIF5B. This gene encodes eIF5B. Factors eIF1A and eIF5B interact on the ribosome along with other initiation factors and GTP to position the initiation methionine tRNA on the start codon of the mRNA so that translation initiates accurately.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
138,827 Da
NCBI Official Full Name
eukaryotic translation initiation factor 5B
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 5B
NCBI Official Symbol
EIF5B
NCBI Official Synonym Symbols
IF2
NCBI Protein Information
eukaryotic translation initiation factor 5B
UniProt Protein Name
Eukaryotic translation initiation factor 5B
UniProt Gene Name
EIF5B
UniProt Synonym Gene Names
IF2; KIAA0741; eIF-5B
Similar Products
Product Notes
The EIF5B eif5b (Catalog #AAA115037) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 629-846aa; partial. The amino acid sequence is listed below: LRAPIICVLG HVDTGKTKIL DKLRHTHVQD GEAGGITQQI GATNVPLEAI NEQTKMIKNF DRENVRIPGM LIIDTPGHES FSNLRNRGSS LCDIAILVVD IMHGLEPQTI ESINLLKSKK CPFIVALNKI DRLYDWKKSP DSDVAATLKK QKKNTKDEFE ERAKAIIVEF AQQGLNAALF YENKDPRTFV SLVPTSAHTG DGMGSLIYLL VELTQTML. It is sometimes possible for the material contained within the vial of "Eukaryotic translation initiation factor 5B (EIF5B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.