Heat-labile enterotoxin B chain Recombinant Protein | eltB recombinant protein
Recombinant Escherichia coli Heat-labile enterotoxin B chain
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Heat-labile enterotoxin B chain; N/A; Recombinant Escherichia coli Heat-labile enterotoxin B chain; LT-B, human; LTH-B; eltB recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-124 . Full Length of Mature Protein
Sequence
APQSITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMEN
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for eltB recombinant protein
The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase.
References
Nucleotide sequence comparison between heat-labile toxin B-subunit cistrons from Escherichia coli of human and porcine origin.Leong J., Vinal A.C., Dallas W.S.Infect. Immun. 48:73-77(1985) Germani Y., Desperrier J.-M. A unique amino acid sequence of the B subunit of a heat-labile enterotoxin isolated from a human enterotoxigenic Escherichia coli.Tsuji T., Iida T., Honda T., Miwatani T., Nagahama M., Sakurai J., Wada K., Matsubara H.Microb. Pathog. 2:381-390(1987) Identification of errors among database sequence entries and comparison of correct amino acid sequences for the heat-labile enterotoxins of Escherichia coli and Vibrio cholerae.Domenighini M., Pizza M., Jobling M.G., Holmes R.K., Rappuoli R.Mol. Microbiol. 15:1165-1167(1995) Crystal structure of the B subunit of Escherichia coli heat-labile enterotoxin carrying peptides with anti-herpes simplex virus type 1 activity.Matkovic-Calogovic D., Loregian A., D'Acunto M.R., Battistutta R., Tossi A., Palu G., Zanotti G.J. Biol. Chem. 274:8764-8769(1999)
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
17 kDa
NCBI Official Full Name
enterotoxin
UniProt Protein Name
Heat-labile enterotoxin B chain
UniProt Gene Name
eltB
UniProt Synonym Gene Names
ltpB
UniProt Entry Name
ELBH_ECOLX
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The eltB eltb (Catalog #AAA114950) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-124. Full Length of Mature Protein. The amino acid sequence is listed below: APQSITELCS EYHNTQIYTI NDKILSYTES MAGKREMVII TFKSGATFQV EVPGSQHIDS QKKAIERMKD TLRITYLTET KIDKLCVWNN KTPNSIAAIS MEN. It is sometimes possible for the material contained within the vial of "Heat-labile enterotoxin B chain, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
