Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA79313_SDS_PAGE15.jpg SDS-PAGE (SDS-PAGE analysis of recombinant human soluble Endomucin produced in E.Coli. Sample was loaded in 15% SDS-Polyacrylamide gel under reducing condition and stained with coomassie blue)

Endomucin Recombinant Protein | EMCN recombinant protein

Human Endomucin

Average rating 0.0
No ratings yet
Gene Names
EMCN; EMCN2; MUC14
Reactivity
Human
Purity
> 95% by SDS-PAGE & silver stain
Synonyms
Endomucin; N/A; Human Endomucin; Recombinant Human Soluble Endomucin; Endomucin-2; Gastric cancer antigen Ga34; Mucin-14; EMCN recombinant protein
Ordering
Host
E Coli
Reactivity
Human
Purity/Purification
> 95% by SDS-PAGE & silver stain
Form/Format
Lyophilized
Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMNSTGVLEAANNSLVVTTTKPSITTP NTESLQKNVVTPTTGTTPKGTITNELLKMSLMSTATFLTSKDEGLKATTT DVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTTEIPGSVLQ PDASPSKTGTLTSIPVTIPENTSQSQVIGTEGGKNASTSATSRSYSS
Sequence Length
197
Reconstitution
The lyophilized human soluble endomucin is soluble in water and most aqueous buffers; it should be reconstituted in water or PBS to a concentration of not lower than 100ug/ml
Preparation and Storage
The material is stable for greater than six months at -20 degree C to -70 degree C. After the first thawing it is recommended to aliquote the material, because repeated freeze-thaw cycles will decrease the activity.

SDS-PAGE

(SDS-PAGE analysis of recombinant human soluble Endomucin produced in E.Coli. Sample was loaded in 15% SDS-Polyacrylamide gel under reducing condition and stained with coomassie blue)

product-image-AAA79313_SDS_PAGE15.jpg SDS-PAGE (SDS-PAGE analysis of recombinant human soluble Endomucin produced in E.Coli. Sample was loaded in 15% SDS-Polyacrylamide gel under reducing condition and stained with coomassie blue)
Related Product Information for EMCN recombinant protein
Endomucin (endothelial sialomucin; also Endomucin-1/2 and Mucin-14) is an 80 - 120 kDa glycoprotein member of the Endomucin family of proteins. It is expressed on endothelial cells and depending upon its glycosylation pattern, can serve as either a pro- or anti-adhesive molecule. Mouse Endomucin precursor is 261 amino acids in length. It is type I transmembrane protein that contains a 170 aa extracellular domain (ECD) (aa 21 - 190) and a 50 aa cytoplasmic region. Three splice variants exist in the ECD. One shows a deletion of aa 91 - 141, a second shows a one aa substitution for aa 91 - 129, and a third shows a one aa substitution for aa 129 - 142. Over aa 21 - 90, mouse Endomucin shares 60% and 30% aa identity with rat and human Endomucin, respectively.
Product Categories/Family for EMCN recombinant protein
References
1. Kinoshita M et al, FEBS Lett 499 (1-2): 121, 2001 2. Kuhn A et al, J Invest Dermatol 119:1388, 2002 3. Matsubara A et al, J Exp Medicine 202:1483, 2005 4. Brachtendorf G et al, Dev Dyn 222:410, 2001 5. Morgan SM et al, Blood 93:165, 1999 6. Samulowitz U et al, Am J Path 160:1669, 2002

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20.4 kDa (Monomer)
NCBI Official Full Name
endomucin isoform 2
NCBI Official Synonym Full Names
endomucin
NCBI Official Symbol
EMCN
NCBI Official Synonym Symbols
EMCN2; MUC14
NCBI Protein Information
endomucin; MUC-14; mucin-14; endomucin-2; gastric cancer antigen Ga34
UniProt Protein Name
Endomucin
UniProt Gene Name
EMCN
UniProt Synonym Gene Names
EMCN2; MUC14; MUC-14
UniProt Entry Name
MUCEN_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The EMCN emcn (Catalog #AAA79313) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The Human Endomucin reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: MGSSHHHHHH SSGLVPRGSH MGSHMNSTGV LEAANNSLVV TTTKPSITTP NTESLQKNVV TPTTGTTPKG TITNELLKMS LMSTATFLTS KDEGLKATTT DVRKNDSIIS NVTVTSVTLP NAVSTLQSSK PKTETQSSIK TTEIPGSVLQ PDASPSKTGT LTSIPVTIPE NTSQSQVIGT EGGKNASTSA TSRSYSS. It is sometimes possible for the material contained within the vial of "Endomucin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.