Enhanced green fluorescence protein EGFP-mCherry Recombinant Protein

Recombinant Human Enhanced green fluorescence protein EGFP-mCherry

Cat. Num. AAA55774

• Purity: > 90% as determined by SDS-PAGE
• Synonyms: Enhanced green fluorescence protein EGFP-mCherry; N/A; Recombinant Human Enhanced green fluorescence protein EGFP-mCherry; GFP, Green fluorescent protein; Enhanced green fluorescence protein EGFP-mCherry recombinant protein

• Host: E Coli 1-239 AA
• Purity/Purification: > 90% as determined by SDS-PAGE
• Form/Format: PBS with 0.02% sodium azide and 15% glycerol pH 7.3
• Concentration: 1.5 mg/mL (varies by lot)
• Sequence Positions: MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

• Source: Human
• Protein Residues: with N-terminal 6X His-tagged
• Usage: Centrifuge the standard vial at 6000-10000rpm for 30s.
• Preparation and Storage: Store it under sterile conditions at -20°C upon receipt. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. The recombinant protein is stable for up to 6-12 months from date of receipt at -80°C.

SDS-PAGE

Related Product Information for Enhanced green fluorescence protein EGFP-mCherry recombinant protein

Green fluorescent protein has been engineered to produce a vast number of variously colored mutants, fusion proteins, and biosensors. Green fluorescent protein can be mutated to emit at different wavelengths such as blue for BFP (when Tyr-66 is replaced by His), cyan for CFP (when Tyr-66 is replaced by Trp), and yellow for YFP (when Thr-203 is replaced by Tyr). Further generation of mutants led to more stable proteins (at 37 degrees Celsius for example) with brighter fluorescence and longer fluorescence lifetimes. Fluorescent proteins and their mutated allelic forms have become a useful and ubiquitous tool for making chimeric proteins, where they function as a fluorescent protein tag. Typically they tolerate N- and C-terminal fusion to a broad variety of proteins. They have been expressed in most known cell types and are used as a noninvasive fluorescent marker in living cells and organisms. They enable a wide range of applications where they have functioned as a cell lineage tracer, reporter of gene expression, or as a measure of protein-protein interactions.