Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283359_AD13.jpg Application Data (Recombinant Rat Erythropoietin/EPO stimulates cell proliferation assay using TF-1 Human erythroleukemic cells. The ED<sub>50</sub> for this effect is 0.7-2.8 ng/mL, corresponding to a specific activity of 3.57×10<sup>5</sup>~1.43×10<sup>6</sup> units/mg.)

Erythropoietin/EPO Recombinant Protein | EPO recombinant protein

Recombinant Rat Erythropoietin/EPO Protein

Average rating 0.0
No ratings yet
Synonyms
Erythropoietin/EPO; N/A; Recombinant Rat Erythropoietin/EPO Protein; Erythropoietin, Epo; EPO recombinant protein
Ordering
Host
HEK293 cells
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
Sequence
APPRLICDSRVLERYILEAKEAENVTMGCAEGPRLSENITVPDTKVNFYAWKRMKVEEQAVEVWQGLSLLSEAILQAQALQANSSQPPESLQLHIDKAISGLRSLTSLLRVLGAQKELMSPPDATQAAPLRTLTADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR
Species
Rat
Tag
C-His
Endotoxin
<0.1EU/ug of the protein by LAL method.
Bio-Activity
Measured in a cell proliferation assay using TF-1 Human erythroleukemic cells. The ED50 for this effect is 0.7-2.8ng/mL, corresponding to a specific activity of 3.57×105~1.43×106 units/mg.
Preparation and Storage
Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

Application Data

(Recombinant Rat Erythropoietin/EPO stimulates cell proliferation assay using TF-1 Human erythroleukemic cells. The ED<sub>50</sub> for this effect is 0.7-2.8 ng/mL, corresponding to a specific activity of 3.57×10<sup>5</sup>~1.43×10<sup>6</sup> units/mg.)

product-image-AAA283359_AD13.jpg Application Data (Recombinant Rat Erythropoietin/EPO stimulates cell proliferation assay using TF-1 Human erythroleukemic cells. The ED<sub>50</sub> for this effect is 0.7-2.8 ng/mL, corresponding to a specific activity of 3.57×10<sup>5</sup>~1.43×10<sup>6</sup> units/mg.)

SDS-PAGE

(Recombinant Rat Erythropoietin/EPO Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 30-40 kDa.)

product-image-AAA283359_SDS_PAGE15.jpg SDS-PAGE (Recombinant Rat Erythropoietin/EPO Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 30-40 kDa.)
Related Product Information for EPO recombinant protein
Erythropoietin (EPO), originally identified for its critical hormonal role in promoting erythrocyte survival and differentiation, is a member of the large and diverse cytokine superfamily. EPO and EPOR function as the primary mediators of a general protective response to tissue hypoxia, which acts to maintain adequate tissue oxygenation through adjustments of circulating red cell mass by using a hormonal feedback-control system involving the kidney and the bone marrow. EPO and EPORs are also expressed by other tissues and organs, including the brain and heart. EPO has also been shown to stimulate mitosis and signaling in astrocytes, endothelial cells, cardiomyoblasts, and cardiomyocytes maintained in vitro
Product Categories/Family for EPO recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
UniProt Protein Name
Erythropoietin
UniProt Gene Name
Epo
UniProt Entry Name
EPO_RAT

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The EPO epo (Catalog #AAA283359) is a Recombinant Protein produced from HEK293 cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: APPRLICDSR VLERYILEAK EAENVTMGCA EGPRLSENIT VPDTKVNFYA WKRMKVEEQA VEVWQGLSLL SEAILQAQAL QANSSQPPES LQLHIDKAIS GLRSLTSLLR VLGAQKELMS PPDATQAAPL RTLTADTFCK LFRVYSNFLR GKLKLYTGEA CRRGDR. It is sometimes possible for the material contained within the vial of "Erythropoietin/EPO, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.