Endoplasmic reticulum aminopeptidase 1 (Erap1), partial Recombinant Protein | Erap1 recombinant protein
Recombinant Mouse Endoplasmic reticulum aminopeptidase 1 (Erap1), partial
Gene Names
Erap1; Arts1; ERAAP; PILSA; PILSAP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Endoplasmic reticulum aminopeptidase 1 (Erap1), partial; N/A; Recombinant Mouse Endoplasmic reticulum aminopeptidase 1 (Erap1), partial; Endoplasmic reticulum aminopeptidase 1; EC=3.4.11.-; ARTS-1; Adipocyte-derived leucine aminopeptidase; A-LAP; Aminopeptidase PILS; Puromycin-insensitive leucyl-specific aminopeptidase; PILS-AP; VEGF-induced aminopeptidase; Erap1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
731-930aa; Partial
Sequence
PCVQRAERYFREWKSSNGNMSIPIDVTLAVFAVGAQNTEGWDFLYSKYQSSLSSTEKSQIEFSLCTSKDPEKLQWLLDQSFKGEIIKTQEFPHILTLIGRNPVGYPLAWKFLRENWNKLVQKFELGSSSIAHMVMGTTDQFSTRARLEEVKGFFSSLKENGSQLRCVQQTIETIEENIRWMDKNFDKIRLWLQKEKPELL
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Erap1 recombinant protein
Aminopeptidase that plays a central role in peptide trimming, a step required for the generation of most HLA class I-binding peptides. Peptide trimming is essential to customize longer precursor peptides to fit them to the correct length required for presentation on MHC class I molecules. Strongly prefers substrates 9-16 residues long. Rapidly degrades 13-mer to a 9-mer and then stops. Preferentially hydrolyzes the residue Leu and peptides with a hydrophobic C-terminus, while it has weak activity toward peptides with charged C-terminus. May play a role in the inactivation of peptide hormones. May be involved in the regulation of blood pressure through the inactivation of angiotensin II and/or the generation of bradykinin in the kidney (By similarity).
Product Categories/Family for Erap1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
28.3 kDa
NCBI Official Full Name
endoplasmic reticulum aminopeptidase 1
NCBI Official Synonym Full Names
endoplasmic reticulum aminopeptidase 1
NCBI Official Symbol
Erap1
NCBI Official Synonym Symbols
Arts1; ERAAP; PILSA; PILSAP
NCBI Protein Information
endoplasmic reticulum aminopeptidase 1; A-LAP; ARTS-1; PILS-AP; aminopeptidase PILS; VEGF-induced aminopeptidase; adipocyte-derived leucine aminopeptidase; puromycin-insensitive leucyl-specific aminopeptidase; type 1 tumor necrosis factor receptor shedding aminopeptidase regulator
UniProt Protein Name
Endoplasmic reticulum aminopeptidase 1
UniProt Gene Name
Erap1
UniProt Synonym Gene Names
Appils; Arts1; A-LAP; PILS-AP
UniProt Entry Name
ERAP1_MOUSE
Similar Products
Product Notes
The Erap1 erap1 (Catalog #AAA117003) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 731-930aa; Partial. The amino acid sequence is listed below: PCVQRAERYF REWKSSNGNM SIPIDVTLAV FAVGAQNTEG WDFLYSKYQS SLSSTEKSQI EFSLCTSKDP EKLQWLLDQS FKGEIIKTQE FPHILTLIGR NPVGYPLAWK FLRENWNKLV QKFELGSSSI AHMVMGTTDQ FSTRARLEEV KGFFSSLKEN GSQLRCVQQT IETIEENIRW MDKNFDKIRL WLQKEKPELL. It is sometimes possible for the material contained within the vial of "Endoplasmic reticulum aminopeptidase 1 (Erap1), partial, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
