Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283362_AD13.jpg Application Data (Recombinant Mouse EREG stimulates cell proliferation assay using Balb3T3 mouse fibroblast cells. The ED<sub>50</sub> for this effect is 140.58-562.31 ng/mL, corresponding to a specific activity of 1.78×10<sup>3</sup>~7.11×10<sup>3</sup> units/mg.)

EREG recombinant protein

Recombinant Mouse EREG Protein

Average rating 0.0
No ratings yet
Synonyms
EREG; N/A; Recombinant Mouse EREG Protein; Proepiregulin, Cleaved into: Epiregulin, EPR, Ereg; EREG recombinant protein
Ordering
Host
HEK293 cells
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
Sequence
VQITKCSSDMDGYCLHGQCIYLVDMREKFCRCEVGYTGLRCEHFFL
Species
Mouse
Tag
N-hFc
Endotoxin
<0.1 EU/ug of the protein by LAL method.
Bio-Activity
Measured in a cell proliferation assay using Balb3T3 mouse fibroblast cells. The ED50 for this effect is 140.58-562.31ng/mL, corresponding to a specific activity of 1.78×103~7.11×103 units/mg.
Preparation and Storage
Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

Application Data

(Recombinant Mouse EREG stimulates cell proliferation assay using Balb3T3 mouse fibroblast cells. The ED<sub>50</sub> for this effect is 140.58-562.31 ng/mL, corresponding to a specific activity of 1.78×10<sup>3</sup>~7.11×10<sup>3</sup> units/mg.)

product-image-AAA283362_AD13.jpg Application Data (Recombinant Mouse EREG stimulates cell proliferation assay using Balb3T3 mouse fibroblast cells. The ED<sub>50</sub> for this effect is 140.58-562.31 ng/mL, corresponding to a specific activity of 1.78×10<sup>3</sup>~7.11×10<sup>3</sup> units/mg.)

SDS-PAGE

(Recombinant Human Cyr61/CCN1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 35-40kDa.)

product-image-AAA283362_SDS_PAGE15.jpg SDS-PAGE (Recombinant Human Cyr61/CCN1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 35-40kDa.)
Related Product Information for EREG recombinant protein
Epiregulin (EREG) is a member of the epidermal growth factor family. Epiregulin (EREG) can function as a ligand of EGFR (epidermal growth factor receptor), as well as a ligand of most members of the ERBB (v-erb-b2 oncogene homolog) family of tyrosine-kinase receptors. Epiregulin (EREG) exhibit bifunctional regulatory properties: it inhibit the growth of several epithelial tumor cells and stimulated the growth of fibroblasts and various other types of cells. Epiregulin (EREG) bound to the EGF receptors of epidermoid carcinoma A431 cells much more weakly than did EGF, but was nevertheless much more potent than EGF as a mitogen for rat primary hepatocytes and Balb/c 3T3 A31 fibroblasts. These findings suggest that epiregulin (EREG) plays important roles in regulating the growth of epithelial cells and fibroblasts by binding to receptors for EGF-related ligands. Epiregulin (EREG) is the broadest specificity EGF-like ligand so far characterized: not only does it stimulate homodimers of both ErbB-1 and ErbB-4, it also activates all possible heterodimeric ErbB complexes.
Product Categories/Family for EREG recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
UniProt Protein Name
Proepiregulin
UniProt Gene Name
Ereg
UniProt Synonym Gene Names
EPR
UniProt Entry Name
EREG_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The EREG ereg (Catalog #AAA283362) is a Recombinant Protein produced from HEK293 cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: VQITKCSSDM DGYCLHGQCI YLVDMREKFC RCEVGYTGLR CEHFFL. It is sometimes possible for the material contained within the vial of "EREG, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.