Streptavidin Active Protein
Recombinant Streptavidin
Purity
Greater than 98.0% as determined by SDS-PAGE and RP-HPLC.
Synonyms
Streptavidin; N/A; Recombinant Streptavidin; Streptavidin Recombinant; Streptavidin active protein
Host
Escherichia Coli
Purity/Purification
Greater than 98.0% as determined by SDS-PAGE and RP-HPLC.
Form/Format
Lyophilized in 10mM potassium phosphate buffer pH 6.5
Sequence
MAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS
Sequence Length
183
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder
Specific Activity
> 17U/mg (one unit binds 1 ug D-biotin)
Proteolytic Activity
<10-3 U/mg protein (Azocoll, 25°C, 24h, pH 8.0)
Solubility
It is recommended to reconstitute the lyophilized Streptavidin in sterile 18MΩ-cm H2O not less than 0.5 mg/ml, which can then be further diluted to other aqueous solutions.
Preparation and Storage
Streptavidin is shipped at ambient tempeture , upon arrival store at -20°C.
Related Product Information for Streptavidin active protein
Streptavidin Streptomyces Avidinii Recombinant produced in E Coli. The molecular weight per tetramer is approximately 52kDa.
Product Categories/Family for Streptavidin active protein
NCBI and Uniprot Product Information
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Streptavidin (Catalog #AAA10864) is an Active Protein produced from Escherichia Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MAEAGITGTW YNQLGSTFIV TAGADGALTG TYESAVGNAE SRYVLTGRYD SAPATDGSGT ALGWTVAWKN NYRNAHSATT WSGQYVGGAE ARINTQWLLT SGTTEANAWK STLVGHDTFT KVKPSAAS. It is sometimes possible for the material contained within the vial of "Streptavidin, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.