SDS-PAGE
EZH2 recombinant protein
Recombinant Human Histone-lysine N-methyltransferase EZH2 (EZH2) Protein
Gene Names
EZH2; WVS; ENX1; EZH1; KMT6; WVS2; ENX-1; EZH2b; KMT6A
Applications
SDS-Page, ELISA, Western Blot
Purity
> 90% as determined by SDS-PAGEAffinity purification
Synonyms
EZH2; N/A; Recombinant Human Histone-lysine N-methyltransferase EZH2 (EZH2) Protein; ENX-1; ENX1; EZH1; EZH2b; KMT6; KMT6A; WVS; WVS2; EZH2 recombinant protein
Host
E. coli
Purity/Purification
> 90% as determined by SDS-PAGE
Affinity purification
Affinity purification
Form/Format
Lyophilized powder.
The purified protein was resolved in PBS (58mM Na2HPO4, 17mM NaH2PO4, 68mM NaCl, pH7.4). The elution buffer contained 300 mM imidazole.
The purified protein was resolved in PBS (58mM Na2HPO4, 17mM NaH2PO4, 68mM NaCl, pH7.4). The elution buffer contained 300 mM imidazole.
Applicable Applications for EZH2 recombinant protein
SDS-PAGE, ELISA, WB (Western Blot)
Source
Human
Tag
N-terminal 6*His-tag
Residues
Met158-Met261 (Q15910)
Usage
Reconstitute in PBS or others.
Protein Sequences
HGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECT
Usage
We recommend that this vial be briefly conetrifuged prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1 mg/ml. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long term storage at -20°C to -80°C
Preparation and Storage
Short Term: Store at 2-8°C
Long Term: Aliquot and store at -20°C to -80°C, buffer containing 50% glycerol is recommended for reconstitution
Avoid repeated freeze-thaw cycles
Long Term: Aliquot and store at -20°C to -80°C, buffer containing 50% glycerol is recommended for reconstitution
Avoid repeated freeze-thaw cycles
SDS-PAGE
SDS-PAGE
Related Product Information for EZH2 recombinant protein
Enhancer of zeste homolog 2 (EZH2) is a histone-lysine N-methyltransferase enzyme (EC 2.1.1.43) encoded by EZH2 gene, that participates in DNA methylation and, ultimately, transcriptional repression. EZH2 catalyzes the addition of methyl groups to histone H3 at lysine 27, by using the cofactor S-adenosyl-L-methionine. Methylation activity of EZH2 facilitates heterochromatin formation thereby silences gene function. Remodeling of chromosomal heterochromatin by EZH2 is also required during cell mitosis. EZH2 is the catalytic subunit of the Polycomb repressive complex 2 (PRC2). EZH2's catalytic activity relies on its formation of a complex with at least two other PRC2 components, SUZ12 and EED. As a histone methyltransferase (HMTase), EZH2's primary function is to methylate Lys-27 on histone 3 (H3K27me) by transferring a methyl group from the cofactor S-adenosyl-L-methionine (SAM), although recent studies have indicated that it is also capable of methylating non-histone proteins. EZH2 is capable of mono-, di-, and tri-methylation of H3K27 and has been associated with a variety of biological functions, including transcriptional repression and activation, hematopoiesis, development, and cell differentiation.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
17 kDa
NCBI Official Full Name
histone-lysine N-methyltransferase EZH2 isoform c
NCBI Official Synonym Full Names
enhancer of zeste 2 polycomb repressive complex 2 subunit
NCBI Official Symbol
EZH2
NCBI Official Synonym Symbols
WVS; ENX1; EZH1; KMT6; WVS2; ENX-1; EZH2b; KMT6A
NCBI Protein Information
histone-lysine N-methyltransferase EZH2
UniProt Protein Name
Histone-lysine N-methyltransferase EZH2
UniProt Gene Name
EZH2
UniProt Synonym Gene Names
KMT6
UniProt Entry Name
EZH2_HUMAN
Similar Products
Product Notes
The EZH2 ezh2 (Catalog #AAA55967) is a Recombinant Protein produced from E. coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's EZH2 can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the EZH2 ezh2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EZH2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.