Coagulation factor XII (F12) Recombinant Protein | F12 recombinant protein
Recombinant Pig Coagulation factor XII (F12), partial
Gene Names
F12; FXII
Reactivity
Pig
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Coagulation factor XII (F12); N/A; Recombinant Pig Coagulation factor XII (F12), partial; Hageman factor; F12 recombinant protein
Host
E Coli
Reactivity
Pig
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Tris-based buffer, 50% glycerol
Sequence Positions
Partial, 20-371aa
Sequence
IPPWKDPRKHKVMASEHTVVLTVTGEPCHFPFQYYRQLYYKCIQRGQRGPRPWCATTPNFEKDQRWAYCLEPMKVKDHCNKGNPCQKGGTCVNMPNGPHCICPDHFTGKHCQKEKCFEPQFLQFFQENEIWHRFEPAGVSKCQCKGPKAQCKPVASQVCSTNPCLNGGSCLQTEGHRLCRCPTGYAGRLCDVDLKERCYSDRGLSYRGMAQTTLSGAPCQPWASEATYWNMTAEQALNWGLGDHAFCRNPDNDTRPWCFVWRGDQLSWQYCRLARCQAPIGEAPPILTPTQSPSEHQDSPLLSREPQPTTQTPSQNLTSAWCAPPEQRGPLPSAGLVGCGQRLRKRLSSLNR
Tag Info
N-terminal 6xHis-tagged
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Related Product Information for F12 recombinant protein
Factor XII is a serum glycoprotein that participates in the initiation of blood coagulation, fibrinolysis, and the generation of bradykinin and angiotensin. Prekallikrein is cleaved by factor XII to form kallikrein, which then cleaves factor XII first to alpha-factor XIIa and then trypsin cleaves it to beta-factor XIIa. Alpha-factor XIIa activates factor XI to factor XIa (By similarity).
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43.89 kDa
NCBI Official Full Name
coagulation factor XII
NCBI Official Symbol
F12
NCBI Official Synonym Symbols
FXII
NCBI Protein Information
coagulation factor XII
UniProt Protein Name
Coagulation factor XII
UniProt Gene Name
F12
UniProt Synonym Gene Names
HAF
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The F12 f12 (Catalog #AAA309818) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Partial, 20-371aa. The Recombinant Pig Coagulation factor XII (F12), partial reacts with Pig and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: IPPWKDPRKH KVMASEHTVV LTVTGEPCHF PFQYYRQLYY KCIQRGQRGP RPWCATTPNF EKDQRWAYCL EPMKVKDHCN KGNPCQKGGT CVNMPNGPHC ICPDHFTGKH CQKEKCFEPQ FLQFFQENEI WHRFEPAGVS KCQCKGPKAQ CKPVASQVCS TNPCLNGGSC LQTEGHRLCR CPTGYAGRLC DVDLKERCYS DRGLSYRGMA QTTLSGAPCQ PWASEATYWN MTAEQALNWG LGDHAFCRNP DNDTRPWCFV WRGDQLSWQY CRLARCQAPI GEAPPILTPT QSPSEHQDSP LLSREPQPTT QTPSQNLTSA WCAPPEQRGP LPSAGLVGCG QRLRKRLSSL NR. It is sometimes possible for the material contained within the vial of "Coagulation factor XII (F12), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
