Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA114144_SDS_PAGE15.jpg SDS-PAGE

Coagulation factor V Recombinant Protein | F5 recombinant protein

Recombinant Human Coagulation factor V

Average rating 0.0
No ratings yet
Gene Names
F5; FVL; PCCF; THPH2; RPRGL1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Coagulation factor V; N/A; Recombinant Human Coagulation factor V; Activated protein C cofactor; Proaccelerin, labile factor; F5 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1490-1614aa; Partial
Sequence
MPSPSSPTLNDTFLSKEFNPLVIVGLSKDGTDYIEIIPKEEVQSSEDDYAEIDYVPYDDPYKTDVRTNINSSRDPDNIAAWYLRSNNGNRRNYYIAAEEISWDYSEFVQRETDIEDSDDIPEDTT
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA114144_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for F5 recombinant protein
Central regulator of hostasis. It serves as a critical cofactor for the prothrombinase activity of factor Xa that results in the activation of prothrombin to thrombin.
Product Categories/Family for F5 recombinant protein
References
Complete cDNA and derived amino acid sequence of human factor V.Jenny R.J., Pittman D.D., Toole J.J., Kriz R.W., Aldape R.A., Hewick R.M., Kaufman R.J., Mann K.G.Proc. Natl. Acad. Sci. U.S.A. 84:4846-4850(1987) Structure of the gene for human coagulation factor V.Cripe L.D., Moore K.D., Kane W.H.Biochemistry 31:3777-3785(1992) SeattleSNPs variation discovery resourceThe DNA sequence and biological annotation of human chromosome 1.Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.Nature 441:315-321(2006) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Cloning of cDNAs coding for the heavy chain region and connecting region of human factor V, a blood coagulation factor with four types of internal repeats.Kane W.H., Ichinose A., Hagen F.S., Davie E.W.Biochemistry 26:6508-6514(1987) Human coagulation factor V, exon 13, missense mutation Asn713Ser.Kostka H.Studies on hereditary deficiency of coagulation factor V.Xie F., Cheng F., Zhu X.Zhonghua Xue Ye Xue Za Zhi 22:453-456(2001) Cloning of a cDNA coding for human factor V, a blood coagulation factor homologous to factor VIII and ceruloplasmin.Kane W.H., Davie E.W.Proc. Natl. Acad. Sci. U.S.A. 83:6800-6804(1986) The serine protease cofactor factor V is synthesized by lymphocytes.Shen N.L.L., Fan S.-T., Pyati J., Graff R., Lapolla R.J., Edgington T.S.J. Immunol. 150:2992-3001(1993) Mechanism of inhibition of activated protein C by protein C inhibitor.Suzuki K., Nishioka J., Kusumoto H., Hashimoto S.J. Biochem. 95:187-195(1984) Coagulation Factor V contains copper ion.Mann K.G., Lawler C.M., Vehar G.A., Church W.R.J. Biol. Chem. 259:12949-12951(1984) Inactivation of human plasma kallikrein and factor XIa by protein C inhibitor.Meijers J.C., Kanters D.H., Vlooswijk R.A., van Erp H.E., Hessing M., Bouma B.N.Biochemistry 27:4231-4237(1988) Posttranslational sulfation of factor V is required for efficient thrombin cleavage and activation and for full procoagulant activity.Pittman D.D., Tomkinson K.N., Michnick D., Selighsohn U., Kaufman R.J.Biochemistry 33:6952-6959(1994) Sulfation of tyrosine residues in coagulation factor V.Hortin G.L.Blood 76:946-952(1990) The mechanism of inactivation of human factor V and human factor Va by activated protein C.Kalafatis M., Rand M.D., Mann K.G.J. Biol. Chem. 269:31869-31880(1994) Characterization of semenogelin II and its molecular interaction with prostate-specific antigen and protein C inhibitor.Kise H., Nishioka J., Kawamura J., Suzuki K.Eur. J. Biochem. 238:88-96(1996) Protein C inhibitor secreted from activated platelets efficiently inhibits activated protein C on phosphatidylethanolamine of platelet membrane and microvesicles.Nishioka J., Ning M., Hayashi T., Suzuki K.J. Biol. Chem. 273:11281-11287(1998) Mutations in coagulation factors in women with unexplained late fetal loss.Martinelli I., Taioli E., Cetin I., Marinoni A., Gerosa S., Villa M.V., Bozzo M., Mannucci P.M.N. Engl. J. Med. 343:1015-1018(2000) Characterization of a novel human protein C inhibitor (PCI) gene transgenic mouse useful for studying the role of PCI in physiological and pathological conditions.Hayashi T., Nishioka J., Kamada H., Asanuma K., Kondo H., Gabazza E.C., Ido M., Suzuki K.J. Thromb. Haemost. 2:949-961(2004) Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.J. Proteome Res. 4:2070-2080(2005) Elucidation of N-glycosylation sites on human platelet proteins a glycoproteomic approach.Lewandrowski U., Moebius J., Walter U., Sickmann A.Mol. Cell. Proteomics 5:226-233(2006) Phosphoproteome of resting human platelets.Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J., Schuetz C., Walter U., Gambaryan S., Sickmann A.J. Proteome Res. 7:526-534(2008) Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.Sci. Signal. 2:RA46-RA46(2009) Crystal structures of the membrane-binding C2 domain of human coagulation factor V.Macedo-Ribeiro S., Bode W., Huber R., Quinn-Allen M.A., Kim S.W., Ortel T.L., Bourenkov G.P., Bartunik H.D., Stubbs M.T., Kane W.H., Fuentes-Prior P.Nature 402:434-439(1999) A polymorphism in the human coagulation factor V gene.Bayston T.A., Ireland H., Olds R.J., Thein S.L., Lane D.A.Hum. Mol. Genet. 3:2085-2085(1994) Mutation in blood coagulation factor V associated with resistance to activated protein C.Bertina R.M., Koeleman B.P.C., Koster T., Rosendaal F.R., Dirven R.J., de Ronde H., van der Velden P.A., Reitsma P.H.Nature 369:64-67(1994) Detection of new polymorphic markers in the factor V gene association with factor V levels in plasma.Lunghi B., Iacoviello L., Gemmati D., Dilasio M.G., Castoldi E., Pinotti M., Castaman G., Redaelli R., Mariani G., Marchetti G., Bernardi F.Thromb. Haemost. 75:45-48(1996) Prevalence of the factor V Leiden mutation in hepatic and portal vein thrombosis.Mahmoud A.E.A., Elias E., Beauchamp N., Wilde J.T.Gut 40:798-800(1997) A novel mutation of Arg306 of factor V gene in Hong Kong Chinese.Chan W.P., Lee C.K., Kwong Y.L., Lam C.K., Liang R.Blood 91:1135-1139(1998) Factor V Cambridge a new mutation (Arg306-to-Thr) associated with resistance to activated protein C.Williamson D., Brown K., Luddington R., Baglin C., Baglin T.Blood 91:1140-1144(1998) Clinical significance of Arg306 mutations of factor V gene.Liang R., Lee C.K., Wat M.S., Kwong Y.L., Lam C.K., Liu H.W.Blood 92:2599-2600(1998) Characterization of single-nucleotide polymorphisms in coding regions of human genes.Cargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N., Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L., Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q., Lander E.S.Nat. Genet. 22:231-238(1999) ErratumCargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N., Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L., Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q., Lander E.S.Nat. Genet. 23:373-373(1999) Combinations of 4 mutations (FV R506Q, FV H1299R, FV Y1702C, PT 20210G/A) affecting the prothrombinase complex in a thrombophilic family.Castoldi E., Simioni P., Kalafatis M., Lunghi B., Tormene D., Girelli D., Girolami A., Bernardi F.Blood 96:1443-1448(2000) Five novel mutations in the gene for human blood coagulation factor V associated with type I factor V deficiency.van Wijk R., Nieuwenhuis K., van den Berg M., Huizinga E.G., van der Meijden B.B., Kraaijenhagen R.J., van Solinge W.W.Blood 98:358-367(2001) Novel factor V C2-domain mutation (R2074H) in two families with factor V deficiency and bleeding.Schrijver I., Houissa-Kastally R., Jones C.D., Garcia K.C., Zehnder J.L.Thromb. Haemost. 87:294-299(2002) Arg2074Cys missense mutation in the C2 domain of factor V causing moderately severe factor V deficiency molecular characterization by expression of the recombinant protein.Duga S., Montefusco M.C., Asselta R., Malcovati M., Peyvandi F., Santagostino E., Mannucci P.M., Tenchini M.L.Blood 101:173-177(2003) Factor V I359T a novel mutation associated with thrombosis and resistance to activated protein C.Mumford A.D., McVey J.H., Morse C.V., Gomez K., Steen M., Norstrom E.A., Tuddenham E.G.D., Dahlback B., Bolton-Maggs P.H.B.Br. J. Haematol. 123:496-501(2003) Meta-analysis of genetic studies in ischemic stroke thirty-two genes involving approximately 18,000 cases and 58,000 controls.Casas J.P., Hingorani A.D., Bautista L.E., Sharma P.Arch. Neurol. 61:1652-1661(2004) Functional characterization of factor V-Ile359Thr a novel mutation associated with thrombosis.Steen M., Norstroem E.A., Tholander A.-L., Bolton-Maggs P.H.B., Mumford A., McVey J.H., Tuddenham E.G.D., Dahlbaeck B.Blood 103:3381-3387(2004) The consensus coding sequences of human breast and colorectal cancers.Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V., Gazdar A.F., Hartigan J., Wu L., Liu C., Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N., Vogelstein B., Kinzler K.W., Velculescu V.E.Science 314:268-274(2006) +Additional computationally mapped references.<p>Provides general information on the entry.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30.4 kDa
NCBI Official Full Name
coagulation factor V preproprotein
NCBI Official Synonym Full Names
coagulation factor V
NCBI Official Symbol
F5
NCBI Official Synonym Symbols
FVL; PCCF; THPH2; RPRGL1
NCBI Protein Information
coagulation factor V
UniProt Protein Name
Coagulation factor V
UniProt Gene Name
F5
UniProt Entry Name
FA5_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The F5 f5 (Catalog #AAA114144) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1490-1614aa; Partial. The amino acid sequence is listed below: MPSPSSPTLN DTFLSKEFNP LVIVGLSKDG TDYIEIIPKE EVQSSEDDYA EIDYVPYDDP YKTDVRTNIN SSRDPDNIAA WYLRSNNGNR RNYYIAAEEI SWDYSEFVQR ETDIEDSDDI PEDTT. It is sometimes possible for the material contained within the vial of "Coagulation factor V, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.