Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA114928_SDS_PAGE15.jpg SDS-PAGE

Fatty acid desaturase 2 Recombinant Protein | FADS2 recombinant protein

Recombinant Human Fatty acid desaturase 2

Average rating 0.0
No ratings yet
Gene Names
FADS2; D6D; DES6; TU13; FADSD6; LLCDL2; SLL0262
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fatty acid desaturase 2; N/A; Recombinant Human Fatty acid desaturase 2; Acyl-CoA 6-desaturase; Delta(6) fatty acid desaturase; D6D; Delta(6) desaturase; Delta-6 desaturase; FADS2 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-131aa; Partial
Sequence
MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMNLFKTNHV
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA114928_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for FADS2 recombinant protein
Component of a lipid metabolic pathway that catalyzes biosynthesis of highly unsaturated fatty acids (HUFA) from precursor essential polyunsaturated fatty acids (PUFA) linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3). Catalyzes the first and rate limiting step in this pathway which is the desaturation of LA (18:2n-6) and ALA (18:3n-3) into gamma-linoleic acid (GLA) (18:3n-6) and stearidonic acid (18:4n-3) respectively and other desaturation steps. Highly unsaturated fatty acids (HUFA) play pivotal roles in many biological functions. It catalizes as well the introduction of a cis double bond in palmitate to produce the mono-unsaturated fatty acid sapienate, the most abundant fatty acid in sebum.
Product Categories/Family for FADS2 recombinant protein
References
"Cloning, expression, and nutritional regulation of the mammalian Delta-6 desaturase." Cho H.P., Nakamura M.T., Clarke S.D. J. Biol. Chem. 274:471-477(1999)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30.9 kDa
NCBI Official Full Name
fatty acid desaturase 2 isoform 2
NCBI Official Synonym Full Names
fatty acid desaturase 2
NCBI Official Symbol
FADS2
NCBI Official Synonym Symbols
D6D; DES6; TU13; FADSD6; LLCDL2; SLL0262
NCBI Protein Information
fatty acid desaturase 2
UniProt Protein Name
Fatty acid desaturase 2
UniProt Gene Name
FADS2
UniProt Synonym Gene Names
D6D; Delta(6) desaturase; Delta-6 desaturase
UniProt Entry Name
FADS2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The FADS2 fads2 (Catalog #AAA114928) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-131aa; Partial. The amino acid sequence is listed below: MGKGGNQGEG AAEREVSVPT FSWEEIQKHN LRTDRWLVID RKVYNITKWS IQHPGGQRVI GHYAGEDATD AFRAFHPDLE FVGKFLKPLL IGELAPEEPS QDHGKNSKIT EDFRALRKTA EDMNLFKTNH V. It is sometimes possible for the material contained within the vial of "Fatty acid desaturase 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.