Tumor necrosis factor ligand superfamily member 6 Recombinant Protein | FASLG recombinant protein

Recombinant Human Tumor necrosis factor ligand superfamily member 6

Cat. Num. AAA114094

• Gene Names: FASLG; APTL; FASL; CD178; CD95L; ALPS1B; CD95-L; TNFSF6; TNLG1A; APT1LG1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Tumor necrosis factor ligand superfamily member 6; N/A; Recombinant Human Tumor necrosis factor ligand superfamily member 6; Apoptosis antigen ligand; APTLCD95 ligand; CD95-LFas antigen ligand; Fas ligand; FasL; CD178; FASLG recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 130-281aa; Full Length of Mature Protein
• Sequence: QIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for FASLG recombinant protein

Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. May be involved in cytotoxic T-cell mediated apoptosis and in T-cell development. TNFRSF6/FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. Binding to the decoy receptor TNFRSF6B/DcR3 modulates its effects.

Product Categories/Family for FASLG recombinant protein

Apoptosis

References

Fas ligand mediates activation-induced cell death in human T lymphocytes.Alderson M.J. Exp. Med. 181:71-77(1995) Human Fas ligand gene structure, chromosomal location and species specificity.Takahashi T., Tanaka M., Inazawa J., Abe T., Suda T., Nagata S.Int. Immunol. 6:1567-1574(1994) Schaetzlein C.E., Poehlmann R., Philippsen P., Eibel H.Role of Fas ligand in apoptosis induced by hepatitis C virus infection.Mita E., Hayashi N., Iio S., Takehara T., Hijioka T., Kasahara A., Fusamoto H., Kamada T.Biochem. Biophys. Res. Commun. 204:468-474(1994) Isolation and characterization of a new naturally occurring variant of human Fas ligand that is expressed only in membrane bound form.Zeytun A., Nagarkatti M., Nagarkatti P.S. The DNA sequence and biological annotation of human chromosome 1.Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.Nature 441:315-321(2006) Matsumura M., Nakanishi Y., Ohba Y. Fas ligand mutation in a patient with systemic lupus erythematosus and lymphoproliferative disease.Wu J., Wilson J., He J., Xiang L., Schur P.H., Mountz J.D.J. Clin. Invest. 98:1107-1113(1996) Characterization of Fas (Apo-1, CD95) -Fas ligand interaction.Schneider P., Bodmer J.-L., Holler N., Mattmann C., Scuderi P., Terskikh A., Peitsch M.C., Tschopp J.J. Biol. Chem. 272:18827-18833(1997) Downregulation of Fas ligand by shedding.Tanaka M., Itai T., Adachi M., Nagata S.Nat. Med. 4:31-36(1998) The Fas ligand intracellular domain is released by ADAM10 and SPPL2a cleavage in T-cells.Kirkin V., Cahuzac N., Guardiola-Serrano F., Huault S., Luckerath K., Friedmann E., Novac N., Wels W.S., Martoglio B., Hueber A.O., Zornig M.Cell Death Differ. 14:1678-1687(2007) Sorting of Fas ligand to secretory lysosomes is regulated by mono-ubiquitylation and phosphorylation.Zuccato E., Blott E.J., Holt O., Sigismund S., Shaw M., Bossi G., Griffiths G.M.J. Cell Sci. 120:191-199(2007) Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening.Voss M., Lettau M., Janssen O.BMC Immunol. 10:53-53(2009)

NCBI and Uniprot Product Information

• NCBI GI #: 4557329
• NCBI GeneID: 356
• NCBI Accession #: NP_000630.1
• NCBI GenBank Nucleotide #: NM_000639.2
• UniProt Accession #: P48023; Q9BZP9
• Molecular Weight: 19.3 kDa
• NCBI Official Full Name: tumor necrosis factor ligand superfamily member 6 isoform 1
• NCBI Official Synonym Full Names: Fas ligand
• NCBI Official Symbol: FASLG
• NCBI Official Synonym Symbols: APTL; FASL; CD178; CD95L; ALPS1B; CD95-L; TNFSF6; TNLG1A; APT1LG1
• NCBI Protein Information: tumor necrosis factor ligand superfamily member 6
• UniProt Protein Name: Tumor necrosis factor ligand superfamily member 6
• UniProt Gene Name: FASLG
• UniProt Synonym Gene Names: APT1LG1; CD95L; FASL; TNFSF6; APTL; CD95-L; Fas ligand; FasL; sFasL; APL; FasL ICD; SPA
• UniProt Entry Name: TNFL6_HUMAN