SDS-PAGE
(12% SDS-PAGE of recombinant Ag85b protein)
Ag85b recombinant protein
Ag85b Protein
Applications
Western Blot, ELISA
Purity
Greater than 90% (analysis by SDS-PAGE Coomassie brilliant blue stained gel)
Synonyms
Ag85b; N/A; Ag85b Protein; Ag85b recombinant protein
Host
Purified from recombinant E Coli strain by affinity chromatography.
Purity/Purification
Greater than 90% (analysis by SDS-PAGE Coomassie brilliant blue stained gel)
Form/Format
PBS , pH7.4
Concentration
1mg/ml (varies by lot)
Sequence
MTDVSRKIRAWGRRLMIGTAAAWLPGLVGLAGGAATAGAFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFL TSELPQWLSAN RAVKPTGSAAI G LSMAGSSAMI LAA YH PQ Q F IYAGSLSALLDPSQG MGP SLIG LAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFV RSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG
Sequence Length
285
Applicable Applications for Ag85b recombinant protein
WB (Western Blot), ELISA
Organism
Mycobacterium tuberculosis
Tag
N-His
Preparation and Storage
Store at-20°C for half a year in its original formulation. Avoid freeze-thaw cycles of the protein solution.
SDS-PAGE
(12% SDS-PAGE of recombinant Ag85b protein)
SDS-PAGE
(12% SDS-PAGE of recombinant Ag85b protein)
Related Product Information for Ag85b recombinant protein
Protein names: Antigen 85-B (Rv1886c) [Gene ID: 13881589; Accession#: AAK46207.1]
Function: Proteins of the antigen 85 complex are responsible for the high affinity ofmycobacteria to fibronectin. Possesses a mycolyltransferase activity required for the biogenesis of trehalose dimycolate (cord factor), a dominant structure necessary formaintaining cell wall integrit
Function: Proteins of the antigen 85 complex are responsible for the high affinity ofmycobacteria to fibronectin. Possesses a mycolyltransferase activity required for the biogenesis of trehalose dimycolate (cord factor), a dominant structure necessary formaintaining cell wall integrit
NCBI and Uniprot Product Information
NCBI GI #
Molecular Weight
Molecular Weight (fusion protein) : 34.5kD (containing amino acid residue 1 to 325 of the Ag85b protein.
NCBI Official Full Name
antigen 85-B, partial
UniProt Protein Name
Diacylglycerol acyltransferase/mycolyltransferase Ag85B
UniProt Gene Name
fbpB
UniProt Synonym Gene Names
DGAT; 85B; Ag85B; Fbps B
Similar Products
Product Notes
The Ag85b fbpb (Catalog #AAA267270) is a Recombinant Protein produced from Purified from recombinant E Coli strain by affinity chromatography. and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Ag85b can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ELISA. Researchers should empirically determine the suitability of the Ag85b fbpb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTDVSRKIRA WGRRLMIGTA AAWLPGLVGL AGGAATAGAF SRPGLPVEYL QVPSPSMGRD IKVQFQSGGN NSPAVYLLDG LRAQDDYNGW DINTPAFEWY YQSGLSIVMP VGGQSSFYSD WYSPACGKAG CQTYKWETFL TSELPQWLSA N RAVKPTGSAA I G LSMAGSSAMI LAA YH PQ Q F IYAGSLSALL DPSQG MGP SLIG LAMGDAGGYK AADMWGPSSD PAWERNDPTQ QIPKLVANNT RLWVYCGNGT PNELGGANIP AEFLENFV RSSNLKFQDA YNAAGGHNAV FNFPPNGTHS WEYWGAQLNA MKGDLQSSLG AG. It is sometimes possible for the material contained within the vial of "Ag85b, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.