Diacylglycerol acyltransferase/mycolyltransferase Ag85C (fbpC) Recombinant Protein | fbpC recombinant protein
Recombinant Mycobacterium tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85C (fbpC)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Diacylglycerol acyltransferase/mycolyltransferase Ag85C (fbpC); N/A; Recombinant Mycobacterium tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85C (fbpC); Acyl-CoA:diacylglycerol acyltransferase; Antigen 85 complex C; 85C; Ag85C; Fibronectin-binding protein C; Fbps C; fbpC recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
46-340aa; Full Length of Mature Protein
Sequence
AFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNGATPPAAPAAPAA
Species
Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for fbpC recombinant protein
The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria to fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M. tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM
References
"Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains."
Fleischmann R.D., Alland D., Eisen J.A., Carpenter L., White O., Peterson J.D., DeBoy R.T., Dodson R.J., Gwinn M.L., Haft D.H., Hickey E.K., Kolonay J.F., Nelson W.C., Umayam L.A., Ermolaeva M.D., Salzberg S.L., Delcher A., Utterback T.R. Fraser C.M.
J. Bacteriol. 184:5479-5490(2002)
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
36.1 kDa
NCBI Official Full Name
MULTISPECIES: diacylglycerol acyltransferase
UniProt Protein Name
Diacylglycerol acyltransferase/mycolyltransferase Ag85C
UniProt Gene Name
fbpC
UniProt Synonym Gene Names
mpt45; DGAT; 85C; Ag85C; Fbps C
UniProt Entry Name
A85C_MYCTO
Similar Products
Product Notes
The fbpC fbpc (Catalog #AAA18597) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 46-340aa; Full Length of Mature Protein. The amino acid sequence is listed below: AFSRPGLPVE YLQVPSASMG RDIKVQFQGG GPHAVYLLDG LRAQDDYNGW DINTPAFEEY YQSGLSVIMP VGGQSSFYTD WYQPSQSNGQ NYTYKWETFL TREMPAWLQA NKGVSPTGNA AVGLSMSGGS ALILAAYYPQ QFPYAASLSG FLNPSEGWWP TLIGLAMNDS GGYNANSMWG PSSDPAWKRN DPMVQIPRLV ANNTRIWVYC GNGTPSDLGG DNIPAKFLEG LTLRTNQTFR DTYAADGGRN GVFNFPPNGT HSWPYWNEQL VAMKADIQHV LNGATPPAAP AAPAA. It is sometimes possible for the material contained within the vial of "Diacylglycerol acyltransferase/mycolyltransferase Ag85C (fbpC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.