Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA230844_SDS_PAGE15.jpg SDS-PAGE

High affinity immunoglobulin epsilon receptor subunit alpha Recombinant Protein | Fcer1a recombinant protein

High affinity immunoglobulin epsilon receptor subunit alpha

Average rating 0.0
No ratings yet
Gene Names
Fcer1a; FcERI; Fce1a; Fcr-5; fcepsilonri
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
High affinity immunoglobulin epsilon receptor subunit alpha; N/A; Fcer1a recombinant protein
Ordering
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
24-250aa; Full Length of Mature Protein
Sequence
ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKCKYYWLQLIFPLLVAILFAVDTGLLLSTEEQFKSVLEIQKTGKYKKVETELLT
Species
Mus musculus (Mouse)
Production Note
Special Offer: The Cell Free host-expressed protein is manufactured from a stock plasmid containing the protein gene. Cell Freehost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Cell Free host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Cell Free host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-PAGE

product-image-AAA230844_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for Fcer1a recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Fcer1a recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44.7 kDa
NCBI Official Full Name
high affinity immunoglobulin epsilon receptor subunit alpha
NCBI Official Synonym Full Names
Fc receptor, IgE, high affinity I, alpha polypeptide
NCBI Official Symbol
Fcer1a
NCBI Official Synonym Symbols
FcERI; Fce1a; Fcr-5; fcepsilonri
NCBI Protein Information
high affinity immunoglobulin epsilon receptor subunit alpha
UniProt Protein Name
High affinity immunoglobulin epsilon receptor subunit alpha
UniProt Gene Name
Fcer1a
UniProt Synonym Gene Names
Fce1a; FcERI
UniProt Entry Name
FCERA_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Fcer1a fcer1a (Catalog #AAA230844) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-250aa; Full Length of Mature Protein. The amino acid sequence is listed below: ATEKSVLTLD PPWIRIFTGE KVTLSCYGNN HLQMNSTTKW IHNGTVSEVN SSHLVIVSAT VQDSGKYICQ KQGLFKSKPV YLNVTQDWLL LQTSADMVLV HGSFDIRCHG WKNWNVRKVI YYRNDHAFNY SYESPVSIRE ATLNDSGTYH CKGYLRQVKY ESDKFRIAVV KAYKCKYYWL QLIFPLLVAI LFAVDTGLLL STEEQFKSVL EIQKTGKYKK VETELLT. It is sometimes possible for the material contained within the vial of "High affinity immunoglobulin epsilon receptor subunit alpha, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.