Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA18767_SDS_PAGE.jpg SDS-PAGE

Fibroblast growth factor 23 (Fgf23) Recombinant Protein | Fgf23 recombinant protein

Recombinant Rat Fibroblast growth factor 23 (Fgf23)

Average rating 0.0
No ratings yet
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fibroblast growth factor 23 (Fgf23); N/A; Recombinant Rat Fibroblast growth factor 23 (Fgf23); Fgf23 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-251aa; Full Length of Mature Protein
Sequence
YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA18767_SDS_PAGE.jpg SDS-PAGE
Related Product Information for Fgf23 recombinant protein
Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Regulator of vitamin-D metabolism. Negatively regulates osteoblasts differentiation and matrix mineralization. Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL.
References
Rattus norvegicus fgf23.Itoh N.Klotho converts canonical FGF receptor into a specific receptor for FGF23.Urakawa I., Yamazaki Y., Shimada T., Iijima K., Hasegawa H., Okawa K., Fujita T., Fukumoto S., Yamashita T.Nature 444:770-774(2006) The parathyroid is a target organ for FGF23 in rats.Ben-Dov I.Z., Galitzer H., Lavi-Moshayoff V., Goetz R., Kuro-o M., Mohammadi M., Sirkis R., Naveh-Many T., Silver J.J. Clin. Invest. 117:4003-4008(2007)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27.5 kDa
NCBI Official Full Name
fibroblast growth factor 23
NCBI Official Synonym Full Names
fibroblast growth factor 23
NCBI Official Symbol
Fgf23
NCBI Protein Information
fibroblast growth factor 23
UniProt Protein Name
Fibroblast growth factor 23
UniProt Gene Name
Fgf23
UniProt Synonym Gene Names
FGF-23
UniProt Entry Name
FGF23_RAT

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Fgf23 fgf23 (Catalog #AAA18767) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-251aa; Full Length of Mature Protein. The amino acid sequence is listed below: YSDTSPLLGS NWGSLTHLYT ATARNSYHLQ IHRDGHVDGT PHQTIYSALM ITSEDAGSVV IIGAMTRRFL CMDLRGNIFG SYHFSPENCR FRQWTLENGY DVYLSPKHHY LVSLGRSKRI FQPGTNPPPF SQFLARRNEV PLLHFYTARP RRHTRSAEDP PERDPLNVLK PRPRATPIPV SCSRELPSAE EGGPAASDPL GVLRRGRGDA RRGAGGTDRC RPFPRFV . It is sometimes possible for the material contained within the vial of "Fibroblast growth factor 23 (Fgf23), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.