Fibroblast growth factor 5 (Fgf5) Recombinant Protein | Fgf5 recombinant protein
Recombinant Mouse Fibroblast growth factor 5 (Fgf5)
Gene Names
Fgf5; go; Fgf-5; HBGF-5; angora
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fibroblast growth factor 5 (Fgf5); N/A; Recombinant Mouse Fibroblast growth factor 5 (Fgf5); Fgf5 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-264aa; Full Length of Mature Protein
Sequence
HGEKRLTPEGQPAPPRNPGDSSGSRGRSSATFSSSSASSPVAASPGSQGSGSEHSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEASVLSILEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHVSTHFLPRFKQSEQPELSFTVTVPEKKKPPVKPKVPLSQPRRSPSPVKYRLKFRFG
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Fgf5 recombinant protein
This protein is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified as an oncogene, which confers transforming potential when transfected into mammalian cells. Targeted disruption of the homolog of this gene in mouse resulted in the phenotype of abnormally long hair, which suggested a function as an inhibitor of hair elongation. Alternatively spliced transcript variants encoding different isoforms have been identified.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
12,675 Da
NCBI Official Full Name
fibroblast growth factor 5 isoform 2
NCBI Official Synonym Full Names
fibroblast growth factor 5
NCBI Official Symbol
Fgf5
NCBI Official Synonym Symbols
go; Fgf-5; HBGF-5; angora
NCBI Protein Information
fibroblast growth factor 5
UniProt Protein Name
Fibroblast growth factor 5
UniProt Gene Name
Fgf5
UniProt Synonym Gene Names
Fgf-5; FGF-5; HBGF-5
Similar Products
Product Notes
The Fgf5 fgf5 (Catalog #AAA113686) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-264aa; Full Length of Mature Protein. The amino acid sequence is listed below: HGEKRLTPEG QPAPPRNPGD SSGSRGRSSA TFSSSSASSP VAASPGSQGS GSEHSSFQWS PSGRRTGSLY CRVGIGFHLQ IYPDGKVNGS HEASVLSILE IFAVSQGIVG IRGVFSNKFL AMSKKGKLHA SAKFTDDCKF RERFQENSYN TYASAIHRTE KTGREWYVAL NKRGKAKRGC SPRVKPQHVS THFLPRFKQS EQPELSFTVT VPEKKKPPVK PKVPLSQPRR SPSPVKYRLK FRFG. It is sometimes possible for the material contained within the vial of "Fibroblast growth factor 5 (Fgf5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.