SDS-PAGE
Fibroblast growth factor 7 Recombinant Protein | FGF7 recombinant protein
Recombinant human Fibroblast growth factor 7
Gene Names
FGF7; KGF; HBGF-7
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fibroblast growth factor 7; N/A; Recombinant human Fibroblast growth factor 7; FGF7 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
32-194, Full length protein
Sequence
CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Sequence Length
163
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for FGF7 recombinant protein
Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation.
Product Categories/Family for FGF7 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,509 Da
NCBI Official Full Name
fibroblast growth factor 7
NCBI Official Synonym Full Names
fibroblast growth factor 7
NCBI Official Symbol
FGF7
NCBI Official Synonym Symbols
KGF; HBGF-7
NCBI Protein Information
fibroblast growth factor 7; FGF-7; keratinocyte growth factor; heparin-binding growth factor 7
UniProt Protein Name
Fibroblast growth factor 7
UniProt Gene Name
FGF7
UniProt Synonym Gene Names
KGF; FGF-7; HBGF-7
UniProt Entry Name
FGF7_HUMAN
Similar Products
Product Notes
The FGF7 fgf7 (Catalog #AAA116215) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 32-194, Full length protein. The amino acid sequence is listed below: CNDMTPEQMA TNVNCSSPER HTRSYDYMEG GDIRVRRLFC RTQWYLRIDK RGKVKGTQEM KNNYNIMEIR TVAVGIVAIK GVESEFYLAM NKEGKLYAKK ECNEDCNFKE LILENHYNTY ASAKWTHNGG EMFVALNQKG IPVRGKKTKK EQKTAHFLPM AIT. It is sometimes possible for the material contained within the vial of "Fibroblast growth factor 7, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.