Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA115578_SDS_PAGE15.jpg SDS-PAGE

Acidic fibroblast growth factor intracellular-binding protein Recombinant Protein | FIBP recombinant protein

Recombinant Human Acidic fibroblast growth factor intracellular-binding protein

Gene Names
FIBP; FGFIBP; FIBP-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Acidic fibroblast growth factor intracellular-binding protein; N/A; Recombinant Human Acidic fibroblast growth factor intracellular-binding protein; FGF-1 intracellular-binding protein; FIBP recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-357aa; Full Length of Isoform Short
Sequence
TSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA115578_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for FIBP recombinant protein
May be involved in mitogenic function of FGF1.
Product Categories/Family for FIBP recombinant protein
References
Cloning of an intracellular protein that binds selectively to mitogenic acidic fibroblast growth factor.Kolpakova E., Wiedlocha A., Stenmark H., Klingenberg O., Falnes P.O., Olsnes S.Biochem. J. 336:213-222(1998)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57.1 kDa
NCBI Official Full Name
acidic fibroblast growth factor intracellular-binding protein isoform b
NCBI Official Synonym Full Names
fibroblast growth factor (acidic) intracellular binding protein
NCBI Official Symbol
FIBP
NCBI Official Synonym Symbols
FGFIBP; FIBP-1
NCBI Protein Information
acidic fibroblast growth factor intracellular-binding protein
UniProt Protein Name
Acidic fibroblast growth factor intracellular-binding protein
UniProt Gene Name
FIBP
UniProt Synonym Gene Names
aFGF intracellular-binding protein
UniProt Entry Name
FIBP_HUMAN

Similar Products

Product Notes

The FIBP fibp (Catalog #AAA115578) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-357aa; Full Length of Isoform Short. The amino acid sequence is listed below: TSELDIFVGN TTLIDEDVYR LWLDGYSVTD AVALRVRSGI LEQTGATAAV LQSDTMDHYR TFHMLERLLH APPKLLHQLI FQIPPSRQAL LIERYYAFDE AFVREVLGKK LSKGTKKDLD DISTKTGITL KSCRRQFDNF KRVFKVVEEM RGSLVDNIQQ HFLLSDRLAR DYAAIVFFAN NRFETGKKKL QYLSFGDFAF CAELMIQNWT LGAVDSQMDD MDMDLDKEFL QDLKELKVLV ADKDLLDLHK SLVCTALRGK LGVFSEMEAN FKNLSRGLVN VAAKLTHNKD VRDLFVDLVE KFVEPCRSDH WPLSDVRFFL NQYSASVHSL DGFRHQALWD RYMGTLRGCL LRLYHD. It is sometimes possible for the material contained within the vial of "Acidic fibroblast growth factor intracellular-binding protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.