Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA115696_SDS_PAGE15.jpg SDS-PAGE

FKBP-type peptidyl-prolyl cis-trans isomerase fkpA (fkpA) Recombinant Protein | fkpA recombinant protein

Recombinant Escherichia coli FKBP-type peptidyl-prolyl cis-trans isomerase fkpA (fkpA)

Average rating 0.0
No ratings yet
Gene Names
fkpA; ECK3334; JW3309; yzzS
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
FKBP-type peptidyl-prolyl cis-trans isomerase fkpA (fkpA); N/A; Recombinant Escherichia coli FKBP-type peptidyl-prolyl cis-trans isomerase fkpA (fkpA); fkpA recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
26-270aa; Full Length of Mature Protein
Sequence
AEAAKPATAADSKAAFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVKPAPKADAKPEADAKAADSAKK
Species
Escherichia coli (strain K12)
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

product-image-AAA115696_SDS_PAGE15.jpg SDS-PAGE

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33.2 kDa
NCBI Official Full Name
FKBP-type peptidyl-prolyl cis-trans isomerase (rotamase)
NCBI Official Symbol
fkpA
NCBI Official Synonym Symbols
ECK3334; JW3309; yzzS
NCBI Protein Information
FKBP-type peptidyl-prolyl cis-trans isomerase (rotamase)
UniProt Protein Name
FKBP-type peptidyl-prolyl cis-trans isomerase FkpA
UniProt Gene Name
fkpA
UniProt Synonym Gene Names
yzzS; PPIase

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The fkpA fkpa (Catalog #AAA115696) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-270aa; Full Length of Mature Protein. The amino acid sequence is listed below: AEAAKPATAA DSKAAFKNDD QKSAYALGAS LGRYMENSLK EQEKLGIKLD KDQLIAGVQD AFADKSKLSD QEIEQTLQAF EARVKSSAQA KMEKDAADNE AKGKEYREKF AKEKGVKTSS TGLVYQVVEA GKGEAPKDSD TVVVNYKGTL IDGKEFDNSY TRGEPLSFRL DGVIPGWTEG LKNIKKGGKI KLVIPPELAY GKAGVPGIPP NSTLVFDVEL LDVKPAPKAD AKPEADAKAA DSAKK. It is sometimes possible for the material contained within the vial of "FKBP-type peptidyl-prolyl cis-trans isomerase fkpA (fkpA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.