Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA18404_SDS_PAGE.jpg SDS-PAGE

Fibronectin Recombinant Protein | FN1 recombinant protein

Recombinant Human Fibronectin

Gene Names
FN1; FN; CIG; FNZ; MSF; ED-B; FINC; GFND; LETS; GFND2
Applications
Calibrator or standard
Purity
85%±5% by SDS-PAGE
Synonyms
Fibronectin; N/A; Recombinant Human Fibronectin; FN1 recombinant protein
Ordering
For Research Use Only!
Host
E. coli
Purity/Purification
85%±5% by SDS-PAGE
Form/Format
Liquid,dissolved in 20mM Tris-HCl, 500mM NaCl, pH 8.0, 50%glycerol
Sequence Positions
627-688aa
Sequence
PIQWNAPQPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTIKGLKPGVVYEGQLISIQQYG
Applicable Applications for FN1 recombinant protein
Calibrator or standard
Tag Info
his-tag
Product Note
Applications are user defined. Product is developed and quality control tested in house, data or additional information may be provided upon request. The researcher needs to establish and confirm the suitability of the product for their application.
Preparation and Storage
Aliquot and store at < 20°C. Avoid repeated freeze / thaw cycles

SDS-PAGE

product-image-AAA18404_SDS_PAGE.jpg SDS-PAGE
Product Categories/Family for FN1 recombinant protein
References
Phenotypic and genetic alterations in mammary stroma implications for tumour progression.Schor S.L., Schor A.M.Breast Cancer Res. 3:373-379(2001) The expression of migration stimulating factor, a potent oncofetal cytokine, is uniquely controlled by 3'-untranslated region-dependent nuclear sequestration of its precursor messenger RNA.Kay R.A., Ellis I.R., Jones S.J., Perrier S., Florence M.M., Schor A.M., Schor S.L.Cancer Res. 65:10742-10749(2005) Vector-capping a simple method for preparing a high-quality full-length cDNA library.Kato S., Ohtoko K., Ohtake H., Kimura T.DNA Res. 12:53-62(2005) Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F. The full-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399(2007) Generation and annotation of the DNA sequences of human chromosomes 2 and 4.Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.Nature 434:724-731(2005) Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C. Human fibronectin is synthesized as a pre-propolypeptide.Gutman A., Yamada K.M., Kornblihtt A.R.FEBS Lett. 207:145-148(1986) Cloning and analysis of the promotor region of the human fibronectin gene.Dean D.C., Bowlus C.L., Bourgeois S.Proc. Natl. Acad. Sci. U.S.A. 84:1876-1880(1987) Primary structure of human fibronectin differential splicing may generate at least 10 polypeptides from a single gene.Kornblihtt A.R., Umezawa K., Vibe-Pedersen K., Baralle F.E.EMBO J. 4:1755-1759(1985) Primary structure of human plasma fibronectin. The 29,000-dalton NH2-terminal domain.Garcia-Pardo A., Pearlstein E., Frangione B.J. Biol. Chem. 258:12670-12674(1983) Godfrey H.P., Ebrahim A.A. Mapping the collagen-binding site of human fibronectin by expression in Escherichia coli.Owens R.J., Baralle F.E.EMBO J. 5:2825-2830(1986) Primary structure of a DNA- and heparin-binding domain (Domain III) in human plasma fibronectin.Calaycay J., Pande H., Lee T., Borsi L., Siri A., Shively J.E., Zardi L.J. Biol. Chem. 260:12136-12141(1985) Identification of novel fibronectin fragments detected specifically in juvenile urine.Iida R., Yasuda T., Kishi K.FEBS J. 274:3939-3947(2007) Human fibronectin cell specific alternative mRNA splicing generates polypeptide chains differing in the number of internal repeats.Kornblihtt A.R., Vibe-Pedersen K., Baralle F.E.Nucleic Acids Res. 12:5853-5868(1984) Sequence analysis and in vivo expression show that alternative splicing of ED-B and ED-A regions of the human fibronectin gene are independent events.Paolella G., Henchcliffe C., Sebastio G., Baralle F.E.Nucleic Acids Res. 16:3545-3557(1988) Transformed human cells produce a new fibronectin isoform by preferential alternative splicing of a previously unobserved exon.Zardi L., Carnemolla B., Siri A., Petersen T.E., Paolella G., Sebastio G., Baralle F.E.EMBO J. 6:2337-2342(1987) Identification of a third region of cell-specific alternative splicing in human fibronectin mRNA.Gutman A., Kornblihtt A.R.Proc. Natl. Acad. Sci. U.S.A. 84:7179-7182(1987) The cell attachment domain of fibronectin. Determination of the primary structure.Pierschbacher M.D., Ruoslahti E., Sundelin J., Lind P., Peterson P.A.J. Biol. Chem. 257:9593-9597(1982) Molecular cloning and nucleotide sequence of a cDNA clone coding for the cell attachment domain in human fibronectin.Oldberg A., Linney E., Ruoslahti E.J. Biol. Chem. 258:10193-10196(1983) Evolution of the fibronectin gene. Exon structure of cell attachment domain.Oldberg A., Ruoslahti E.J. Biol. Chem. 261:2113-2116(1986) Primary structure of human plasma fibronectin. Characterization of a 38 kDa domain containing the C-terminal heparin-binding site (Hep III site) and a region of molecular heterogeneity.Garcia-Pardo A., Rostagno A., Frangione B.Biochem. J. 241:923-928(1987) Human cellular fibronectin comparison of the carboxyl-terminal portion with rat identifies primary structural domains separated by hypervariable regions.Bernard M.P., Kolbe M., Weil D., Chu M.-L.Biochemistry 24:2698-2704(1985) Human plasma fibronectin. Demonstration of structural differences between the A- and B-chains in the III CS region.Tressel T., McCarthy J.B., Calaycay J., Lee T.D., Legesse K., Shively J.E., Pande H.Biochem. J. 274:731-738(1991) Human fibronectin molecular cloning evidence for two mRNA species differing by an internal segment coding for a structural domain.Kornblihtt A.R., Vibe-Pedersen K., Baralle F.E.EMBO J. 3:221-226(1984) Human liver fibronectin complementary DNAs identification of two different messenger RNAs possibly encoding the alpha and beta subunits of plasma fibronectin.Sekiguchi K., Klos A.M., Kurachi K., Yoshitake S., Hakomori S.Biochemistry 25:4936-4941(1986) Novel cartilage-specific splice variants of fibronectin.Parker A.E., Boutell J., Carr A., Maciewicz R.A.Osteoarthritis Cartilage 10:528-534(2002) Isolation and characterization of cDNA clones for human liver fibronectin.Umezawa K., Kornblihtt A.R., Baralle F.E.FEBS Lett. 186:31-34(1985) Donor and acceptor splice signals within an exon of the human fibronectin gene a new type of differential splicing.Vibe-Pedersen K., Magnusson S., Baralle F.E.FEBS Lett. 207:287-291(1986) Primary structure of human plasma fibronectin. Characterization of a 31,000-dalton fragment from the COOH-terminal region containing a free sulfhydryl group and a fibrin-binding site.Garcia-Pardo A., Pearlstein E., Frangione B.J. Biol. Chem. 260:10320-10325(1985) Isolation and characterization of cDNA clones for human and bovine fibronectins.Kornblihtt A.R., Vibe-Pedersen K., Baralle F.E.Proc. Natl. Acad. Sci. U.S.A. 80:3218-3222(1983) Tyrosine sulfation of proteins from the human hepatoma cell line HepG2.Liu M.C., Yu S., Sy J., Redman C.M., Lipmann F.Proc. Natl. Acad. Sci. U.S.A. 82:7160-7164(1985) Purification of a young age-related glycoprotein (Ugl-Y) from normal human urine.Iida R., Yasuda T., Kishi K.J. Biochem. 101:357-363(1987) Fibulin binds to itself and to the carboxyl-terminal heparin-binding region of fibronectin.Balbona K., Tran H., Godyna S., Ingham K.C., Strickland D.K., Argraves W.S.J. Biol. Chem. 267:20120-20125(1992) Further characterization of the NH2-terminal fibrin-binding site on fibronectin.Rostagno A., Williams M.J., Baron M., Campbell I.D., Gold L.I.J. Biol. Chem. 269:31938-31945(1994) Superfibronectin is a functionally distinct form of fibronectin.Morla A., Zhang Z., Ruoslahti E.Nature 367:193-196(1994) Mac-2 binding protein is a cell-adhesive protein of the extracellular matrix which self-assembles into ring-like structures and binds beta1 integrins, collagens and fibronectin.Sasaki T., Brakebusch C., Engel J., Timpl R.EMBO J. 17:1606-1613(1998) A fibronectin fragment inhibits tumor growth, angiogenesis, and metastasis.Yi M., Ruoslahti E.Proc. Natl. Acad. Sci. U.S.A. 98:620-624(2001) The type XIII collagen ectodomain is a 150-nm rod and capable of binding to fibronectin, nidogen-2, perlecan, and heparin.Tu H., Sasaki T., Snellman A., Gohring W., Pirila P., Timpl R., Pihlajaniemi T.J. Biol. Chem. 277:23092-23099(2002) Matrix-matrix interaction of cartilage oligomeric matrix protein and fibronectin.Di Cesare P.E., Chen F.S., Moergelin M., Carlson C.S., Leslie M.P., Perris R., Fang C.Matrix Biol. 21:461-470(2002) In vitro localization of TIGR/MYOC in trabecular meshwork extracellular matrix and binding to fibronectin.Filla M.S., Liu X., Nguyen T.D., Polansky J.R., Brandt C.R., Kaufman P.L., Peters D.M.Invest. Ophthalmol. Vis. Sci. 43:151-161(2002) Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.Bunkenborg J., Pilch B.J., Podtelejnikov A.V., Wisniewski J.R.Proteomics 4:454-465(2004) Anastellin, a fragment of the first type III repeat of fibronectin, inhibits extracellular signal-regulated kinase and causes G(1) arrest in human microvessel endothelial cells.Ambesi A., Klein R.M., Pumiglia K.M., McKeown-Longo P.J.Cancer Res. 65:148-156(2005) Differential analysis of site-specific glycans on plasma and cellular fibronectins application of a hydrophilic affinity method for glycopeptide enrichment.Tajiri M., Yoshida S., Wada Y.Glycobiology 15:1332-1340(2005) Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.J. Proteome Res. 4:2070-2080(2005) Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.Cell 127:635-648(2006) A novel role for fibronectin type I domain in the regulation of human hematopoietic cell adhesiveness through binding to follistatin domains of FLRG and follistatin.Maguer-Satta V., Forissier S., Bartholin L., Martel S., Jeanpierre S., Bachelard E., Rimokh R.Exp. Cell Res. 312:434-442(2006) Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.Han G., Ye M., Zhou H., Jiang X., Feng S., Jiang X., Tian R., Wan D., Zou H., Gu J.Proteomics 8:1346-1361(2008) Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.J. Proteome Res. 8:651-661(2009) A strategy for precise and large scale identification of core fucosylated glycoproteins.Jia W., Lu Z., Fu Y., Wang H.P., Wang L.H., Chi H., Yuan Z.F., Zheng Z.B., Song L.N., Han H.H., Liang Y.M., Wang J.L., Cai Y., Zhang Y.K., Deng Y.L., Ying W.T., He S.M., Qian X.H.Mol. Cell. Proteomics 8:913-923(2009) Regulation of p38 MAP kinase by anastellin is independent of anastellin's effect on matrix fibronectin.You R., Klein R.M., Zheng M., McKeown-Longo P.J.Matrix Biol. 28:101-109(2009) Resveratrol-induced changes of the human adipocyte secretion profile.Rosenow A., Noben J.P., Jocken J., Kallendrusch S., Fischer-Posovszky P., Mariman E.C., Renes J.J. Proteome Res. 11:4733-4743(2012) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) 1H NMR assignment and secondary structure of the cell adhesion type III module of fibronectin.Baron M., Main A.L., Driscoll P.C., Mardon H.J., Boyd J., Campbell I.D.Biochemistry 31:2068-2073(1992) The three-dimensional structure of the tenth type III module of fibronectin an insight into RGD-mediated interactions.Main A.L., Harvey T.S., Baron M., Boyd J., Campbell I.D.Cell 71:671-678(1992) Solution structure of a pair of fibronectin type 1 modules with fibrin binding activity.Williams M.J., Phan I., Harvey T.S., Rostagno A., Gold L.I., Campbell I.D.J. Mol. Biol. 235:1302-1311(1994) High-resolution structural studies of the factor XIIIa crosslinking site and the first type 1 module of fibronectin.Potts J.R., Phan I., Williams M.J., Campbell I.D.Nat. Struct. Biol. 2:946-950(1995) Solution structure of the glycosylated second type 2 module of fibronectin.Sticht H., Pickford A.R., Potts J.R., Campbell I.D.J. Mol. Biol. 276:177-187(1998) NMR structure of the human oncofoetal fibronectin ED-B domain, a specific marker for angiogenesis.Fattorusso R., Pellecchia M., Viti F., Neri P., Neri D., Wuethrich K.Structure 7:381-390(1999) Solution structure of a pair of modules from the gelatin-binding domain of fibronectin.Bocquier A.A., Potts J.R., Pickford A.R., Campbell I.D.Structure 7:1451-1460(1999) The hairpin structure of the (6) F1(1) F2(2) F2 fragment from human fibronectin enhances gelatin binding.Pickford A.R., Smith S.P., Staunton D., Boyd J., Campbell I.D.EMBO J. 20:1519-1529(2001) NMR structure of human fibronectin EDA.Niimi T., Osawa M., Yamaji N., Yasunaga K., Sakashita H., Mase T., Tanaka A., Fujita S.J. Biomol. NMR 21:281-284(2001) Anastellin, an FN3 fragment with fibronectin polymerization activity, resembles amyloid fibril precursors.Briknarova K., Aakerman M.E., Hoyt D.W., Ruoslahti E., Ely K.R.J. Mol. Biol. 332:205-215(2003) Pathogenic bacteria attach to human fibronectin through a tandem beta-zipper.Schwarz-Linek U., Werner J.M., Pickford A.R., Gurusiddappa S., Kim J.H., Pilka E.S., Briggs J.A., Gough T.S., Hoeoek M., Campbell I.D., Potts J.R.Nature 423:177-181(2003) Crystal structure of the tenth type III cell adhesion module of human fibronectin.Dickinson C.D., Veerapandian B., Dai X.-P., Hamlin R.C., Xuong N.-H., Ruoslahti E., Ely K.R.J. Mol. Biol. 236:1079-1092(1994) 2.0 A crystal structure of a four-domain segment of human fibronectin encompassing the RGD loop and synergy region.Leahy D.J., Aukhil I., Erickson H.P.Cell 84:155-164(1996) Crystal structure of a heparin- and integrin-binding segment of human fibronectin.Sharma A., Askari J.A., Humphries M.J., Jones E.Y., Stuart D.I.EMBO J. 18:1468-1479(1999) Structure and functional significance of mechanically unfolded fibronectin type III1 intermediates.Gao M., Craig D., Lequin O., Campbell I.D., Vogel V., Schulten K.Proc. Natl. Acad. Sci. U.S.A. 100:14784-14789(2003) Interdomain association in fibronectin insight into cryptic sites and fibrillogenesis.Vakonakis I., Staunton D., Rooney L.M., Campbell I.D.EMBO J. 26:2575-2583(2007) The solution and crystal structures of a module pair from the Staphylococcus aureus-binding site of human fibronectin -- a tale with a twist.Rudino-Pinera E., Ravelli R.B., Sheldrick G.M., Nanao M.H., Korostelev V.V., Werner J.M., Schwarz-Linek U., Potts J.R., Garman E.F.J. Mol. Biol. 368:833-844(2007) Crystal structures of fibronectin-binding sites from Staphylococcus aureus FnBPA in complex with fibronectin domains.Bingham R.J., Rudino-Pinera E., Meenan N.A.G., Schwarz-Linek U., Turkenburg J.P., Hoeoek M., Garman E.F., Potts J.R.Proc. Natl. Acad. Sci. U.S.A. 105:12254-12258(2008) Solution structure of the 11th FN1 domain from human fibronectin 1.RIKEN structural genomics initiative (RSGI) Submitted (MAR-2008) to the PDB data bankIdentification and structural analysis of type I collagen sites in complex with fibronectin fragments.Erat M.C., Slatter D.A., Lowe E.D., Millard C.J., Farndale R.W., Campbell I.D., Vakonakis I.Proc. Natl. Acad. Sci. U.S.A. 106:4195-4200(2009) The consensus coding sequences of human breast and colorectal cancers.Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V., Gazdar A.F., Hartigan J., Wu L., Liu C., Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N., Vogelstein B., Kinzler K.W., Velculescu V.E.Science 314:268-274(2006) Mutations in FN1 cause glomerulopathy with fibronectin deposits.Castelletti F., Donadelli R., Banterla F., Hildebrandt F., Zipfel P.F., Bresin E., Otto E., Skerka C., Renieri A., Todeschini M., Caprioli J., Caruso R.M., Artuso R., Remuzzi G., Noris M.Proc. Natl. Acad. Sci. U.S.A. 105:2538-2543(2008) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) +Additional computationally mapped references.<p>Provides general information on the entry.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
fibronectin isoform 8
NCBI Official Synonym Full Names
fibronectin 1
NCBI Official Symbol
FN1
NCBI Official Synonym Symbols
FN; CIG; FNZ; MSF; ED-B; FINC; GFND; LETS; GFND2
NCBI Protein Information
fibronectin
UniProt Protein Name
Fibronectin
UniProt Gene Name
FN1
UniProt Synonym Gene Names
FN; FN; CIG
UniProt Entry Name
FINC_HUMAN

Similar Products

Product Notes

The FN1 fn1 (Catalog #AAA18404) is a Recombinant Protein produced from E. coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 627-688aa. AAA Biotech's Fibronectin can be used in a range of immunoassay formats including, but not limited to, Calibrator or standard. Researchers should empirically determine the suitability of the FN1 fn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PIQWNAPQPS HISKYILRWR PKNSVGRWKE ATIPGHLNSY TIKGLKPGVV YEGQLISIQQ YG. It is sometimes possible for the material contained within the vial of "Fibronectin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.