Loading...

Skip to main content
SDS-PAGE

Sperm-egg fusion protein Juno (IZUMO1R) Recombinant Protein | IZUMO1R recombinant protein

Recombinant Human Sperm-egg fusion protein Juno (IZUMO1R)

Gene Names
FOLR4; JUNO; Folbp3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sperm-egg fusion protein Juno (IZUMO1R); N/A; Recombinant Human Sperm-egg fusion protein Juno (IZUMO1R); Probable folate receptor delta; FR-delta; Folate receptor 4; IZUMO1R recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-250aa; Full-Length of the Mature Protein
Sequence
GDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFASSAPSWELSYTIMVCSLFLPFLS
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for IZUMO1R recombinant protein
Receptor for IZUMO1 present at the cell surface of oocytes (oolemma), which is essential for gamete recognition and fertilization. The IZUMO1:IZUMO1R/JUNO interaction is a necessary adhesion event between sperm and egg that is required for fertilization but is not sufficient for cell fusion. The ligand-receptor interaction probably does not act as a membrane 'fusogen'. Does not bind folate (By similarity).
Product Categories/Family for IZUMO1R recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30.3 kDa
NCBI Official Full Name
sperm-egg fusion protein Juno
NCBI Official Synonym Full Names
folate receptor 4, delta (putative)
NCBI Official Symbol
FOLR4
NCBI Official Synonym Symbols
JUNO; Folbp3
NCBI Protein Information
sperm-egg fusion protein Juno; FR-delta; folate receptor delta; probable folate receptor delta; folate receptor 4 (delta) homolog
UniProt Protein Name
Sperm-egg fusion protein Juno
UniProt Gene Name
FOLR4
UniProt Synonym Gene Names
JUNO; FR-delta
UniProt Entry Name
JUNO_HUMAN

Similar Products

Product Notes

The IZUMO1R folr4 (Catalog #AAA18552) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-250aa; Full-Length of the Mature Protein. The amino acid sequence is listed below: GDELLNICMN AKHHKRVPSP EDKLYEECIP WKDNACCTLT TSWEAHLDVS PLYNFSLFHC GLLMPGCRKH FIQAICFYEC SPNLGPWIQP VGSLGWEVAP SGQGERVVNV PLCQEDCEEW WEDCRMSYTC KSNWRGGWDW SQGKNRCPKG AQCLPFSHYF PTPADLCEKT WSNSFKASPE RRNSGRCLQK WFEPAQGNPN VAVARLFASS APSWELSYTI MVCSLFLPFL S. It is sometimes possible for the material contained within the vial of "Sperm-egg fusion protein Juno (IZUMO1R), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.