Application Data
(Recombinant Rat Follistatin/FST Protein neutralize Activin-mediated inhibition on MPC-11 cell proliferation. The ED<sub>50</sub> for this effect is 23.68-94.70 ng/mL, corresponding to a specific activity of 1.06×10<sup>4</sup>~4.22×10<sup>4</sup> units/mg in the presence of 10 ng/mL Recombinant Human Activin A .)
Follistatin/FST Recombinant Protein | Fst recombinant protein
Recombinant Rat Follistatin/FST Protein
Synonyms
Follistatin/FST; N/A; Recombinant Rat Follistatin/FST Protein; Fst, Follistatin, FS, Activin-binding protein; Fst recombinant protein
Host
HEK293 cells
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
Sequence
MVCARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPSSSEQSLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCGGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEETEEEEEEEDQDYSFPISSTLEW
Species
Rat
Tag
C-His
Endotoxin
<0.01EU/ug of the protein by LAL method.
Bio-Activity
Measured by its ability to neutralize Activin-mediated inhibition on MPC-11 cell proliferation. The ED50 for this effect is 23.68-94.70ng/mL, corresponding to a specific activity of 1.06×104~4.22×104 units/mg in the prese
Preparation and Storage
Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
Application Data
(Recombinant Rat Follistatin/FST Protein neutralize Activin-mediated inhibition on MPC-11 cell proliferation. The ED<sub>50</sub> for this effect is 23.68-94.70 ng/mL, corresponding to a specific activity of 1.06×10<sup>4</sup>~4.22×10<sup>4</sup> units/mg in the presence of 10 ng/mL Recombinant Human Activin A .)
Application Data
(Recombinant Rat Follistatin/FST Protein neutralize Activin-mediated inhibition on MPC-11 cell proliferation. The ED<sub>50</sub> for this effect is 23.68-94.70 ng/mL, corresponding to a specific activity of 1.06×10<sup>4</sup>~4.22×10<sup>4</sup> units/mg in the presence of 10 ng/mL Recombinant Human Activin A .)
SDS-PAGE
(Recombinant Rat Follistatin/FST Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 45-50kDa.)
SDS-PAGE
(Recombinant Rat Follistatin/FST Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 45-50kDa.)
Related Product Information for Fst recombinant protein
Enables heparan sulfate proteoglycan binding activity. Predicted to be involved in hematopoietic progenitor cell differentiation; negative regulation of transcription by RNA polymerase II; and regulation of transmembrane receptor protein serine/threonine kinase signaling pathway. Predicted to act upstream of or within several processes, including animal organ development; keratinocyte proliferation; and positive regulation of hair follicle development. Predicted to be located in cytoplasm and nucleus. Predicted to be active in extracellular space. Human ortholog(s) of this gene implicated in polycystic ovary syndrome. Orthologous to human FST (follistatin).
Product Categories/Family for Fst recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Protein Name
Follistatin
UniProt Gene Name
Fst
UniProt Synonym Gene Names
FS
UniProt Entry Name
FST_RAT
Similar Products
Product Notes
The Fst fst (Catalog #AAA283354) is a Recombinant Protein produced from HEK293 cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MVCARHQPGG LCLLLLLLCQ FMEDRSAQAG NCWLRQAKNG RCQVLYKTEL SKEECCSTGR LSTSWTEEDV NDNTLFKWMI FNGGAPNCIP CKETCENVDC GPGKKCRMNK KNKPRCVCAP DCSNITWKGP VCGLDGKTYR NECALLKARC KEQPELEVQY QGKCKKTCRD VFCPGSSTCV VDQTNNAYCV TCNRICPEPS SSEQSLCGND GVTYSSACHL RKATCLLGRS IGLAYEGKCI KAKSCEDIQC GGGKKCLWDF KVGRGRCSLC DELCPDSKSD EPVCASDNAT YASECAMKEA ACSSGVLLEV KHSGSCNSIS EETEEEEEEE DQDYSFPISS TLEW. It is sometimes possible for the material contained within the vial of "Follistatin/FST, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.