Host
HEK293 Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL
Sequence Length
574
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
Fc, 6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
Related Product Information for Fz-7 recombinant protein
Description: Recombinant Human Frizzled-7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln33-Leu185) of human Frizzled-7 (Accession #NP_003498.1) fused with an Fc, 6xHis tag at the C-terminus.
Background: Frizzled-7 is a member of the Frizzled family of unconventional G-protein-coupled glycoprotein receptors for the Wnt signaling pathway. During development, Frizzled-7 is expressed during gastrulation and in the fetal gut, kidney and lung where it is thought to influence tissue morphogenesis via non-canonical signaling pathways. In the adult, Frizzled-7 is expressed in skeletal muscle, especially in satellite cells that mediate muscle regeneration in response to Wnt-7a. It is expressed in embryonic stem cells (ES), contributing to self-renewal signaling. Frizzled-7 expression may downregulate APC function and enhance beta-catenin-mediated signals in poorly differentiated human esophageal carcinomas.
Background: Frizzled-7 is a member of the Frizzled family of unconventional G-protein-coupled glycoprotein receptors for the Wnt signaling pathway. During development, Frizzled-7 is expressed during gastrulation and in the fetal gut, kidney and lung where it is thought to influence tissue morphogenesis via non-canonical signaling pathways. In the adult, Frizzled-7 is expressed in skeletal muscle, especially in satellite cells that mediate muscle regeneration in response to Wnt-7a. It is expressed in embryonic stem cells (ES), contributing to self-renewal signaling. Frizzled-7 expression may downregulate APC function and enhance beta-catenin-mediated signals in poorly differentiated human esophageal carcinomas.
Product Categories/Family for Fz-7 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Frizzled-7
NCBI Official Synonym Full Names
frizzled class receptor 7
NCBI Official Symbol
FZD7
NCBI Official Synonym Symbols
FzE3
NCBI Protein Information
frizzled-7
UniProt Protein Name
Frizzled-7
UniProt Gene Name
FZD7
UniProt Synonym Gene Names
Fz-7; hFz7
UniProt Entry Name
FZD7_HUMAN
Similar Products
Product Notes
The Fz-7 fzd7 (Catalog #AAA281511) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: QPYHGEKGIS VPDHGFCQPI SIPLCTDIAY NQTILPNLLG HTNQEDAGLE VHQFYPLVKV QCSPELRFFL CSMYAPVCTV LDQAIPPCRS LCERARQGCE ALMNKFGFQW PERLRCENFP VHGAGEICVG QNTSDGSGGP GGGPTAYPTA PYL. It is sometimes possible for the material contained within the vial of "Frizzled-7, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
