Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA18731_SDS_PAGE.jpg SDS-PAGE

Glycoprotein (G) Recombinant Protein | G recombinant protein

Recombinant Rabies virus Glycoprotein (G), partial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glycoprotein (G); N/A; Recombinant Rabies virus Glycoprotein (G), partial; G recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-459aa; partial
Sequence
KFPIYTILDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYILAIKMNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYRWLRTVKTTKESLVIISPSVADLDPYDRSLHSRVFPSGKCSGVAVSSTYCSTNHDYTIWMPENPRLGMSCDIFTNSRGKRASKGSETCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSNETKWCPPDQLVNLHDFRSDEIEHLVVEELVRKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEILPSKGCLRVGGRCHPHVNGVFFNGIILGPDGNVLIPEMQSSLLQQHMELLESSVIPLVHPLADPSTVFKDGDEAEDFVEVHLPDVHNQVSGVDLGLPNWGKY
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA18731_SDS_PAGE.jpg SDS-PAGE
Related Product Information for G recombinant protein
Attaches the virus to host cellular receptor, inducing endocytosis of the virion. In the endosome, the acidic pH induces conformational changes in the glycoprotein trimer, which trigger fusion between virus and cell membrane. There is convincing in vitro evidence that the muscular form of the nicotinic acetylcholine receptor (nAChR), the neuronal cell adhesion molecule (NCAM), and the p75 neurotrophin receptor (p75NTR) bind glycoprotein and thereby facilitate rabies virus entry into cells.
References
Structure of the glycoprotein gene in rabies virus.Anilionis A., Wunner W.H., Curtis P.J.Nature 294:275-278(1981) Amino acid sequence of the rabies virus glycoprotein deduced from its cloned gene.Anilionis A., Wunner W.H., Curtis P.J.Comp. Immunol. Microbiol. Infect. Dis. 5:27-32(1982) Complete nucleotide sequencing of SAD derivatives of attenuated rabies virus vaccine strains.Geue L., Schares S., Schnick C., Kliemt J., Beckert A., Hoffmann B., Freuling C., Marston D., McElhinney L., Fooks A., Zanoni R., Peterhans E., Cox J.H., Mueller T. Antigenic variants of CVS rabies virus with altered glycosylation sites.Wunner W.H., Dietzschold B., Smith C.L., Lafon M., Golub E.Virology 140:1-12(1985) N-linked glycosylation of rabies virus glycoprotein. Individual sequons differ in their glycosylation efficiencies and influence on cell surface expression.Shakin-Eshleman S.H., Remaley A.T., Eshleman J.R., Wunner W.H., Spitalnik S.L.J. Biol. Chem. 267:10690-10698(1992) The role of site-specific N-glycosylation in secretion of soluble forms of rabies virus glycoprotein.Wojczyk B.S., Stwora-Wojczyk M., Shakin-Eshleman S.H., Wunner W.H., Spitalnik S.L.Glycobiology 8:121-130(1998) Rabies virus receptors.Lafon M.J. Neurovirol. 11:82-87(2005)

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
50.6
NCBI Official Full Name
Glycoprotein
UniProt Protein Name
Glycoprotein
UniProt Gene Name
G
UniProt Entry Name
GLYCO_RABVE

Similar Products

Product Notes

The G g (Catalog #AAA18731) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-459aa; partial. The amino acid sequence is listed below: KFPIYTILDK LGPWSPIDIH HLSCPNNLVV EDEGCTNLSG FSYMELKVGY ILAIKMNGFT CTGVVTEAET YTNFVGYVTT TFKRKHFRPT PDACRAAYNW KMAGDPRYEE SLHNPYPDYR WLRTVKTTKE SLVIISPSVA DLDPYDRSLH SRVFPSGKCS GVAVSSTYCS TNHDYTIWMP ENPRLGMSCD IFTNSRGKRA SKGSETCGFV DERGLYKSLK GACKLKLCGV LGLRLMDGTW VAMQTSNETK WCPPDQLVNL HDFRSDEIEH LVVEELVRKR EECLDALESI MTTKSVSFRR LSHLRKLVPG FGKAYTIFNK TLMEADAHYK SVRTWNEILP SKGCLRVGGR CHPHVNGVFF NGIILGPDGN VLIPEMQSSL LQQHMELLES SVIPLVHPLA DPSTVFKDGD EAEDFVEVHL PDVHNQVSGV DLGLPNWGKY . It is sometimes possible for the material contained within the vial of "Glycoprotein (G), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.