Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Glutamate Decarboxylase 1, Brain (GAD1) Recombinant Protein | GAD1 recombinant protein

Recombinant Glutamate Decarboxylase 1, Brain (GAD1)

Average rating 0.0
No ratings yet
Gene Names
Gad1; Gad67
Applications
Immunoprecipitation, ELISA, Western Blot, SDS-Page
Purity
> 95%
Synonyms
Glutamate Decarboxylase 1, Brain (GAD1); N/A; Recombinant Glutamate Decarboxylase 1, Brain (GAD1); GAD1 recombinant protein
Ordering
Host
E Coli
Purity/Purification
> 95%
Form/Format
Supplied as lyophilized form in PBS,pH7.4, containing 5% sucrose, 0.01% sarcosyl.
Sequence
The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below.
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-MASSTPSPAT SSNAGADPNT TNLRPTTYDT WCGVAHGCTR KLGLKICGFL QRTNSLEEKS RLVSAFRERQ ASKNLLSCEN SDPGARFRRT ETDFSNL
Sequence Length
593
Applicable Applications for GAD1 recombinant protein
IP (Immunoprecipitation), ELISA, WB (Western Blot), SDS-PAGE
Organism
Rattus norvegicus (Rat)
Expression System
Prokaryotic expression
Residues
Met1~Leu97 (Accession # P18088) with two N-terminal Tags, His-tag and S-tag
Endotoxin Level
<1.0EU per 1ug (determined by the LAL method)
Reconstitution
Reconstitute in sterile PBS, pH7.2-pH7.4.
Preparation and Storage
Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16.3kDa
NCBI Official Full Name
glutamate decarboxylase 1
NCBI Official Synonym Full Names
glutamate decarboxylase 1
NCBI Official Symbol
Gad1
NCBI Official Synonym Symbols
Gad67
NCBI Protein Information
glutamate decarboxylase 1; GAD-67; glutamic acid decarboxylase 1; Glutamate decarboxylase 1 (brain); 67 kDa glutamic acid decarboxylase; glutamate decarboxylase 67 kDa isoform; glutamate decarboxylase 1 variant GAD67NT
UniProt Protein Name
Glutamate decarboxylase 1
UniProt Gene Name
Gad1
UniProt Synonym Gene Names
Gad67; GAD-67
UniProt Entry Name
DCE1_RAT

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The GAD1 gad1 (Catalog #AAA134100) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Glutamate Decarboxylase 1, Brain (GAD1) can be used in a range of immunoassay formats including, but not limited to, IP (Immunoprecipitation), ELISA, WB (Western Blot), SDS-PAGE. Researchers should empirically determine the suitability of the GAD1 gad1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-MASSTPS PAT SSNAGADPNT TNLRPTTYDT WCGVAHGCTR KLGLKICGFL QRTNSLEEKS RLVSAFRERQ ASKNLLSCEN SDPGARFRRT ETDFSNL. It is sometimes possible for the material contained within the vial of "Glutamate Decarboxylase 1, Brain (GAD1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.