Galactocerebrosidase (Galc) Recombinant Protein | Galc recombinant protein
Recombinant Mouse Galactocerebrosidase (Galc)
Gene Names
Galc; twi; Gacy; AW212969; AW413532; twitcher; 2310068B06Rik; A930008M05Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Galactocerebrosidase (Galc); N/A; Recombinant Mouse Galactocerebrosidase (Galc); Galactocerebroside beta-galactosidase; Galactosylceramidase; Galactosylceramide beta-galactosidase; Galc recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
43-684aa; Full Length of Mature Protein
Sequence
YVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGTPQQRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Species
Mus musculus (Mouse)
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Related Product Information for Galc recombinant protein
Hydrolyzes the galactose ester bonds of galactosylceramide, galactosylsphingosine, lactosylceramide, and monogalactosyldiglyceride. Enzyme with very low activity responsible for the lysosomal catabolism of galactosylceramide, a major lipid in myelin, kidney and epithelial cells of small intestine and colon.
Product Categories/Family for Galc recombinant protein
References
"Molecular cloning and expression of cDNA for murine galactocerebrosidase and mutation analysis of the twitcher mouse, a model of Krabbe's disease."Sakai N., Inui K., Tatsumi N., Fukushima H., Nishigaki T., Taniike M., Nishimoto J., Tsukamoto H., Yanagihara I., Ozono K., Okada S.J. Neurochem. 66:1118-1124(1996)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
73.1 kDa
NCBI Official Full Name
galactocerebrosidase
NCBI Official Synonym Full Names
galactosylceramidase
NCBI Official Symbol
Galc
NCBI Official Synonym Symbols
twi; Gacy; AW212969; AW413532; twitcher; 2310068B06Rik; A930008M05Rik
NCBI Protein Information
galactocerebrosidase
UniProt Protein Name
Galactocerebrosidase
UniProt Gene Name
Galc
UniProt Synonym Gene Names
GALCERase
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Galc galc (Catalog #AAA233491) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 43-684aa; Full Length of Mature Protein. The amino acid sequence is listed below: YVLDDSDGLG REFDGIGAVS GGGATSRLLV NYPEPYRSEI LDYLFKPNFG ASLHILKVEI GGDGQTTDGT EPSHMHYELD ENYFRGYEWW LMKEAKKRNP DIILMGLPWS FPGWLGKGFS WPYVNLQLTA YYVVRWILGA KHYHDLDIDY IGIWNERPFD ANYIKELRKM LDYQGLQRVR IIASDNLWEP ISSSLLLDQE LWKVVDVIGA HYPGTYTVWN AKMSGKKLWS SEDFSTINSN VGAGCWSRIL NQNYINGNMT STIAWNLVAS YYEELPYGRS GLMTAQEPWS GHYVVASPIW VSAHTTQFTQ PGWYYLKTVG HLEKGGSYVA LTDGLGNLTI IIETMSHQHS MCIRPYLPYY NVSHQLATFT LKGSLREIQE LQVWYTKLGT PQQRLHFKQL DTLWLLDGSG SFTLELEEDE IFTLTTLTTG RKGSYPPPPS SKPFPTNYKD DFNVEYPLFS EAPNFADQTG VFEYYMNNED REHRFTLRQV LNQRPITWAA DASSTISVIG DHHWTNMTVQ CDVYIETPRS GGVFIAGRVN KGGILIRSAT GVFFWIFANG SYRVTADLGG WITYASGHAD VTAKRWYTLT LGIKGYFAFG MLNGTILWKN VRVKYPGHGW AAIGTHTFEF AQFDNFRVEA AR. It is sometimes possible for the material contained within the vial of "Galactocerebrosidase (Galc), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
