Gastric intrinsic factor Recombinant Protein | GIF recombinant protein

Recombinant Human Gastric intrinsic factor

Cat. Num. AAA113968

• Gene Names: GIF; IF; INF; IFMH; TCN3
• Purity: Greater than 90% as determined by SDS-PAGE.
• Synonyms: Gastric intrinsic factor; N/A; Recombinant Human Gastric intrinsic factor; Intrinsic factor; IF; INF; GIF recombinant protein

• Purity/Purification: Greater than 90% as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 19-417
• Sequence: STQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILP
• Sequence Length: 417

• Product Note: Applications are user defined. Product is developed and quality control tested in house, data or additional information may be provided upon request. The researcher needs to establish and confirm the suitability of the product for their application.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for GIF recombinant protein

Promotes absorption of the essential vitamin cobalamin (Cbl) in the ileum. After interaction with CUBN, the GIF-cobalamin complex is internalized via receptor-mediated endocytosis.

Product Categories/Family for GIF recombinant protein

Transport; Raw Materials Assay Development

References

Human gastric intrinsic factor characterization of cDNA and genomic clones and localization to human chromosome 11.Hewitt J.E., Gordon M.M., Taggart R.T., Mohandas T.K., Alpers D.H.Genomics 10:432-440(1991) A cDNA sequence of the human intrinsic factor.Hannappel M., Kehl M., Winnacker E.L. Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G., Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006) Crystal structure of human intrinsic factor cobalamin complex at 2.6-A resolution.Mathews F.S., Gordon M.M., Chen Z., Rajashankar K.R., Ealick S.E., Alpers D.H., Sukumar N.Proc. Natl. Acad. Sci. U.S.A. 104:17311-17316(2007) Structural basis for receptor recognition of vitamin-B(12) -intrinsic factor complexes.Andersen C.B., Madsen M., Storm T., Moestrup S.K., Andersen G.R.Nature 464:445-448(2010) A genetic polymorphism in the coding region of the gastric intrinsic factor gene (GIF) is associated with congenital intrinsic factor deficiency.Gordon M.M., Brada N., Remacha A., Badell I., del Rio E., Baiget M., Santer R., Quadros E.V., Rothenberg S.P., Alpers D.H.Hum. Mutat. 23:85-91(2004) Hereditary juvenile cobalamin deficiency caused by mutations in the intrinsic factor gene.Tanner S.M., Li Z., Perko J.D., Oener C., Cetin M., Altay C., Yurtsever Z., David K.L., Faivre L., Ismail E.A., Graesbeck R., de la Chapelle A.Proc. Natl. Acad. Sci. U.S.A. 102:4130-4133(2005)

NCBI and Uniprot Product Information

• NCBI GI #: 32189398
• NCBI GeneID: 2694
• NCBI Accession #: NP_005133.2
• NCBI GenBank Nucleotide #: NM_005142.2
• UniProt Accession #: P27352; B2RAN8; B4DVZ1
• Molecular Weight: 59.4kD
• NCBI Official Full Name: gastric intrinsic factor
• NCBI Official Synonym Full Names: gastric intrinsic factor
• NCBI Official Symbol: GIF
• NCBI Official Synonym Symbols: IF; INF; IFMH; TCN3
• NCBI Protein Information: gastric intrinsic factor
• UniProt Protein Name: Gastric intrinsic factor
• UniProt Gene Name: GIF
• UniProt Synonym Gene Names: IFMH; IF; INF
• UniProt Entry Name: IF_HUMAN