Glucagon-like peptide 1 receptor (GLP1R) Recombinant Protein | GLP1R recombinant protein
Recombinant Human Glucagon-like peptide 1 receptor (GLP1R), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glucagon-like peptide 1 receptor (GLP1R); N/A; Recombinant Human Glucagon-like peptide 1 receptor (GLP1R), partial; GLP1R recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
24-145aa; Partial
Sequence
RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
Related Product Information for GLP1R recombinant protein
This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Product Categories/Family for GLP1R recombinant protein
References
Cloning and functional expression of the human islet GLP-1 receptor. Demonstration that exendin-4 is an agonist and exendin-(9-39)
an antagonist of the receptor.Thorens B., Porret A., Buehler L., Deng S., Morel P., Widmann C.Diabetes 42:1678-1682(1993)
Cloning and functional expression of the human glucagon-like peptide-1 (GLP-1)
receptor.Dillon J.S., Tanizawa Y., Wheeler M.B., Leng X., Ligon B.B., Rabin D.U., Yoo-Warren H., Permutt M., Boyd A.E.Endocrinology 133:1907-1910(1993)
Cloning and functional expression of a human glucagon-like peptide-1 receptor.Graziano M.P., Hey P.J., Borkowski D., Chicchi G.C., Strader C.D.Biochem. Biophys. Res. Commun. 196:141-146(1993)
Signal transduction of the GLP-1-receptor cloned from a human insulinoma.van Eyll B., Lankat-Buttgereit B., Bode H.P., Goeke R., Goeke B.FEBS Lett. 348:7-13(1994)
Tissue-specific expression of the human receptor for glucagon-like peptide-I
brain, heart and pancreatic forms have the same deduced amino acid sequences.Wei Y., Mojsov S.FEBS Lett. 358:219-224(1995)
Genome-wide discovery and analysis of human seven transmembrane helix receptor genes.Suwa M., Sato T., Okouchi I., Arita M., Futami K., Matsumoto S., Tsutsumi S., Aburatani H., Asai K., Akiyama Y.NIEHS SNPs programThe DNA sequence and analysis of human chromosome 6.Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D., Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.Nature 425:805-811(2003)
Cloning and characterization of the 5' flanking sequences (promoter region)
of the human GLP-1 receptor gene.Lankat-Buttgereit B., Goeke B.Peptides 18:617-624(1997)
Functional coupling of Cys-226 and Cys-296 in the glucagon-like peptide-1 (GLP-1)
receptor indicates a disulfide bond that is close to the activation pocket.Mann R.J., Al-Sabah S., de Maturana R.L., Sinfield J.K., Donnelly D.Peptides 31:2289-2293(2010)
Glucagon like-peptide-1 receptor is covalently modified by endogenous mono-ADP-ribosyltransferase.Dezelak M., Bavec A.Mol. Biol. Rep. 39:4375-4381(2012)
Regulation of GIP and GLP1 receptor cell surface expression by N-glycosylation and receptor heteromerization.Whitaker G.M., Lynn F.C., McIntosh C.H., Accili E.A.PLoS ONE 7:E32675-E32675(2012)
Crystal structure of the ligand-bound glucagon-like peptide-1 receptor extracellular domain.Runge S., Thogersen H., Madsen K., Lau J., Rudolph R.J. Biol. Chem. 283:11340-11347(2008)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
16.3 kDa
NCBI Official Full Name
glucagon-like peptide 1 receptor
NCBI Official Synonym Full Names
glucagon like peptide 1 receptor
NCBI Official Symbol
GLP1R
NCBI Protein Information
glucagon-like peptide 1 receptor
UniProt Protein Name
Glucagon-like peptide 1 receptor
UniProt Gene Name
GLP1R
UniProt Synonym Gene Names
GLP-1 receptor; GLP-1-R; GLP-1R
UniProt Entry Name
GLP1R_HUMAN
