Glucagon-like peptide 1 receptor (GLP1R) Recombinant Protein | GLP1R recombinant protein

Recombinant Human Glucagon-like peptide 1 receptor (GLP1R), partial

Cat. Num. AAA18419

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Glucagon-like peptide 1 receptor (GLP1R); N/A; Recombinant Human Glucagon-like peptide 1 receptor (GLP1R), partial; GLP1R recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 24-145aa; Partial
• Sequence: RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for GLP1R recombinant protein

This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

Product Categories/Family for GLP1R recombinant protein

Cardiovascular

References

Cloning and functional expression of the human islet GLP-1 receptor. Demonstration that exendin-4 is an agonist and exendin-(9-39) an antagonist of the receptor.Thorens B., Porret A., Buehler L., Deng S., Morel P., Widmann C.Diabetes 42:1678-1682(1993) Cloning and functional expression of the human glucagon-like peptide-1 (GLP-1) receptor.Dillon J.S., Tanizawa Y., Wheeler M.B., Leng X., Ligon B.B., Rabin D.U., Yoo-Warren H., Permutt M., Boyd A.E.Endocrinology 133:1907-1910(1993) Cloning and functional expression of a human glucagon-like peptide-1 receptor.Graziano M.P., Hey P.J., Borkowski D., Chicchi G.C., Strader C.D.Biochem. Biophys. Res. Commun. 196:141-146(1993) Signal transduction of the GLP-1-receptor cloned from a human insulinoma.van Eyll B., Lankat-Buttgereit B., Bode H.P., Goeke R., Goeke B.FEBS Lett. 348:7-13(1994) Tissue-specific expression of the human receptor for glucagon-like peptide-I brain, heart and pancreatic forms have the same deduced amino acid sequences.Wei Y., Mojsov S.FEBS Lett. 358:219-224(1995) Genome-wide discovery and analysis of human seven transmembrane helix receptor genes.Suwa M., Sato T., Okouchi I., Arita M., Futami K., Matsumoto S., Tsutsumi S., Aburatani H., Asai K., Akiyama Y.NIEHS SNPs programThe DNA sequence and analysis of human chromosome 6.Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D., Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.Nature 425:805-811(2003) Cloning and characterization of the 5' flanking sequences (promoter region) of the human GLP-1 receptor gene.Lankat-Buttgereit B., Goeke B.Peptides 18:617-624(1997) Functional coupling of Cys-226 and Cys-296 in the glucagon-like peptide-1 (GLP-1) receptor indicates a disulfide bond that is close to the activation pocket.Mann R.J., Al-Sabah S., de Maturana R.L., Sinfield J.K., Donnelly D.Peptides 31:2289-2293(2010) Glucagon like-peptide-1 receptor is covalently modified by endogenous mono-ADP-ribosyltransferase.Dezelak M., Bavec A.Mol. Biol. Rep. 39:4375-4381(2012) Regulation of GIP and GLP1 receptor cell surface expression by N-glycosylation and receptor heteromerization.Whitaker G.M., Lynn F.C., McIntosh C.H., Accili E.A.PLoS ONE 7:E32675-E32675(2012) Crystal structure of the ligand-bound glucagon-like peptide-1 receptor extracellular domain.Runge S., Thogersen H., Madsen K., Lau J., Rudolph R.J. Biol. Chem. 283:11340-11347(2008)

NCBI and Uniprot Product Information

• NCBI GI #: 166795283
• NCBI GeneID: 2740
• NCBI Accession #: NP_002053.3
• NCBI GenBank Nucleotide #: NM_002062.3
• UniProt Accession #: P43220; Q2M229; Q99669
• Molecular Weight: 16.3 kDa
• NCBI Official Full Name: glucagon-like peptide 1 receptor
• NCBI Official Synonym Full Names: glucagon like peptide 1 receptor
• NCBI Official Symbol: GLP1R
• NCBI Protein Information: glucagon-like peptide 1 receptor
• UniProt Protein Name: Glucagon-like peptide 1 receptor
• UniProt Gene Name: GLP1R
• UniProt Synonym Gene Names: GLP-1 receptor; GLP-1-R; GLP-1R
• UniProt Entry Name: GLP1R_HUMAN