Host
E Coli
Purity/Purification
> 90% purity
Form/Format
In PBS with 8M Urea
Concentration
1 ug/ul in PBS with 8M Urea (varies by lot)
Sequence
KFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPMPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVKTKESLVIISPSVADLDPYDKSLHSRVFPGGKCSGITVSSTCCSTNHDYTIWMPENPRLGTSCDIFTNSRGKRASKGGKTCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAIQTSDEIKWCSPDLVNLHDFHSDEIEHLVVEELVKKREECLDALETIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSIRTWNEIIPSKGCLRVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLHQMELLESSVIPLMHPLADPSTVFKDGDEAEDFVEVHLPDVHKQISGVDLGLPNWGKHHHHHH
Applicable Applications for Glycoprotein of Rabies Virus recombinant protein
ELISA, WB (Western Blot)
Tag
C-terminal 6xHis tagged
Preparation and Storage
This product will expire after one year when kept at -20 degree C. Stable for 1-months from the date of shipment when kept at 4 degree C. Non-hazardous. No MSDS required.
Related Product Information for Glycoprotein of Rabies Virus recombinant protein
Description: 6xHis tagged recombinant protein expressed in E. coli.
Introduction: Rabies lyssavirus (genus of the Rhabdoviridae family), formerly Rabies virus, is a neurotropic virus that causes rabies in humans and animals. Rabies virus is a rod- or bullet-shaped, single-stranded, negative-sense, unsegmented, enveloped RNA virus. The rabies genome encodes five proteins: nucleoprotein (N), phosphoprotein (P), matrix protein (M), glycoprotein (G) and polymerase (L). It has two major structural components: a helical ribonucleoprotein core (RNP) and a surrounding lipoprotein envelope embedded with knob-like Glycoprotein (G) spikes.
Viral Protein: Glycoprotein (amino acid 20-458) of Rabies virus (GenBank Accession No. BAI50726)
Introduction: Rabies lyssavirus (genus of the Rhabdoviridae family), formerly Rabies virus, is a neurotropic virus that causes rabies in humans and animals. Rabies virus is a rod- or bullet-shaped, single-stranded, negative-sense, unsegmented, enveloped RNA virus. The rabies genome encodes five proteins: nucleoprotein (N), phosphoprotein (P), matrix protein (M), glycoprotein (G) and polymerase (L). It has two major structural components: a helical ribonucleoprotein core (RNP) and a surrounding lipoprotein envelope embedded with knob-like Glycoprotein (G) spikes.
Viral Protein: Glycoprotein (amino acid 20-458) of Rabies virus (GenBank Accession No. BAI50726)
Product Categories/Family for Glycoprotein of Rabies Virus recombinant protein
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Glycoprotein of Rabies Virus (Catalog #AAA62082) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Glycoprotein of Rabies Virus can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the Glycoprotein of Rabies Virus for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KFPIYTIPDK LGPWSPIDIH HLSCPNNLVV EDEGCTNLSG FSYMELKVGY ISAIKVNGFT CTGVVTEAET YTNFVGYVTT TFKRKHFRPM PDACRAAYNW KMAGDPRYEE SLHNPYPDYH WLRTVKTKES LVIISPSVAD LDPYDKSLHS RVFPGGKCSG ITVSSTCCST NHDYTIWMPE NPRLGTSCDI FTNSRGKRAS KGGKTCGFVD ERGLYKSLKG ACKLKLCGVL GLRLMDGTWV AIQTSDEIKW CSPDLVNLHD FHSDEIEHLV VEELVKKREE CLDALETIMT TKSVSFRRLS HLRKLVPGFG KAYTIFNKTL MEADAHYKSI RTWNEIIPSK GCLRVGGRCH PHVNGVFFNG IILGPDGHVL IPEMQSSLLH QMELLESSVI PLMHPLADPS TVFKDGDEAE DFVEVHLPDV HKQISGVDLG LPNWGKHHHH HH. It is sometimes possible for the material contained within the vial of "Glycoprotein of Rabies Virus, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
