Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Granulysin Recombinant Protein | GNLY recombinant protein

Recombinant Human Granulysin

Gene Names
GNLY; 519; LAG2; NKG5; LAG-2; D2S69E; TLA519
Purity
Greater than 95.0% as determined by SDS-PAGE.
Synonyms
Granulysin; N/A; Recombinant Human Granulysin; GNLY Human; Granulysin Human Recombinant; LAG2; Lymphokine LAG-2; TLA519; NKG5; D2S69E; T-cell activation protein 519; GNLY; GNLY recombinant protein
Ordering
Host
E Coli
Purity/Purification
Greater than 95.0% as determined by SDS-PAGE.
Form/Format
The Granulysin protein was lyophilized from a concentrated (1mg/ml) solution containing no additives.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
MGSSHHHHHHSSGLVPRGSHMMEGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPLGSHHHHHH
Sequence Length
145
Solubility
It is recommended to reconstitute the lyophilized Granulysin in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Preparation and Storage
Lyophilized Granulysin although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution Granulysin should be stored at 4 degree C between 2-7 days and for future use below -18 degree C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Related Product Information for GNLY recombinant protein
Description: GNLY Human Recombinant produced in E Coli is a single, non-glycosylated, polypeptide chain containing 159 amino acids and fused to a double His Tag (N+C terminus) and having a total molecular mass of 18.1 kDa.The GNLY is purified by proprietary chromatographic techniques.

Introduction: GNLY is part of the SAPLIP family and is located in the cytotoxic granules of T cells, which are discharged upon antigen stimulation. GNLY is localized in cytotoxic granules of cytotoxic T lymphocytes and natural killer cells, and it has antimicrobial activity against M. tuberculosis and other organisms. GNLY is an antimicrobial protein that kills intracellular pathogens. GNLY is active against a wide range of microbes, including Gram-positive and Gram-negative bacteria, fungi, and parasites. Kills Mycobacterium tuberculosis.
Product Categories/Family for GNLY recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
granulysin isoform 2
NCBI Official Synonym Full Names
granulysin
NCBI Official Symbol
GNLY
NCBI Official Synonym Symbols
519; LAG2; NKG5; LAG-2; D2S69E; TLA519
NCBI Protein Information
granulysin; T-cell activation protein 519; T-lymphocyte activation gene 519; lymphocyte-activation gene 2; lymphokine LAG-2
UniProt Protein Name
Granulysin
UniProt Gene Name
GNLY
UniProt Synonym Gene Names
LAG2; NKG5; TLA519
UniProt Entry Name
GNLY_HUMAN

Similar Products

Product Notes

The GNLY gnly (Catalog #AAA38803) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MGSSHHHHHH SSGLVP RGSHMMEGLV FSRLSPEYYD LARAHLRDEE KSCPCLAQEG PQGDLLTKTQ ELGRDYRTCL TIVQKLKKMV DKPTQRSVSN AATRVCRTGR SRWRDVCRNF MRRYQSRVTQ GLVAGETAQQ ICEDLRLCIP STGPLGSHHH HHH. It is sometimes possible for the material contained within the vial of "Granulysin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.