Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA62211_AD15.jpg Application Data

GP Protein Recombinant Protein

GP Protein (aa 33-632) of Zarie Ebolavirus (isolate H.sapiens-wt/GIN/2014/Gueckedou-C07)

Applications
ELISA, Western Blot
Purity
>= 95% (by SDS-PAGE)
Synonyms
GP Protein; N/A; GP Protein (aa 33-632) of Zarie Ebolavirus (isolate H.sapiens-wt/GIN/2014/Gueckedou-C07); GP Protein of Zarie Ebolavirus; GP Protein of Zarie Ebolavirus (isolate H.sapiens-wt/GIN/2014/Gueckedou-C07); Glycoprotein (GP) of Zarie Ebolavirus; GP Protein recombinant protein
Ordering
Purity/Purification
>= 95% (by SDS-PAGE)
Concentration
1 ug/ ul in PBS (varies by lot)
Sequence
IPLGVIHNSTLQVSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYNLEIKKPD GSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREP VNATEDPSSGYYSTTIRYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYASGKRSNTTGKLIWKVNPEIDTTIGE WAFWETKKNLTRKIRSEELSFTAVSNGPKNISGQSPARTSSDPETNTTNEDHKIMASENSSAMVQVHSQGRKAAVSHLTTLATIS TSPQSLTTKPGPDNSTHNTPVYKLDISEATQVGQHHRRADNDSTASDTPPATTAAGPLKAENTNTSKSADSLDLATTTSPQNYSE TAGNNNTHHQDTGEESASSGKLGLITNTIAGVAGLITGGRRTRREVIVNAQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGI YTEGLMHNQDGLICGLRQLANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPHDWTKNITDKIDQII HDFVD
Applicable Applications for GP Protein recombinant protein
ELISA, WB (Western Blot)
Description
Viral protein purified from 293 cell culture
Viral Protein
6x His tagged Glycoprotein (GP) (amino acid 33-632) of Zarie Ebolavirus (isolate H.sapiens wt/GIN/2014/Gueckedou-C07) (Genebank No. KJ660347)
Preparation and Storage
Store at -20 degree C. Stable for 1-month from the date of shipment when kept at 4 degree C. Non-hazardous. No MSDS required.

Application Data

product-image-AAA62211_AD15.jpg Application Data
Related Product Information for GP Protein recombinant protein
Description: 6x His tagged Glycoprotein (GP) (amino acid 33-632) of Zarie Ebolavirus (isolate H.sapiens wt/GIN/2014/Gueckedou-C07) expressed in 293 cells (Genebank No. KJ660347)
Viral protein purified from 293 cell culture
Introduction: The Ebola virus (EBOV) is a mononegavirus which contains a 19 kb single-stand RNA encoding seven proteins. Rates of genetic change of ebolavirus are 100 times slower than influenza A in humans, but on the same magnitude as those of hepatitis B.
The main Ebolavirus glycoprotein (GP) is the only viral protein found on the surface of the Ebola virion and is therefore responsible for mediating attachment and entry of the virus into host cells. The produced GP protein (~120 kDa) is derived from the sequence of a recent Zarie Ebolavirus (ZEBOV) isolate from 2014 outbreak in western Africa.
Product Categories/Family for GP Protein recombinant protein
References
Baize, S, et al. Emergence of Zaire Ebola virus disease in Guinea. N. Engl. J. Med., 371: 1418-1425, 2014.

Similar Products

Product Notes

The GP Protein (Catalog #AAA62211) is a Recombinant Protein and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GP Protein can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the GP Protein for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IPLGVIHNST LQVSDVDKLV CRDKLSSTNQ LRSVGLNLEG NGVATDVPSA TKRWGFRSGV PPKVVNYEAG EWAENCYNLE IKKPD GSEC LPAAPDGIRG FPRCRYVHKV SGTGPCAGDF AFHKEGAFFL YDRLASTVIY RGTTFAEGVV AFLILPQAKK DFFSSHPLRE P VNATEDPS SGYYSTTIRY QATGFGTNET EYLFEVDNLT YVQLESRFTP QFLLQLNETI YASGKRSNTT GKLIWKVNPE IDTTIGE WA FWETKKNLTR KIRSEELSFT AVSNGPKNIS GQSPARTSSD PETNTTNEDH KIMASENSSA MVQVHSQGRK AAVSHLTTLA TIS TSPQSL TTKPGPDNST HNTPVYKLDI SEATQVGQHH RRADNDSTAS DTPPATTAAG PLKAENTNTS KSADSLDLAT TTSPQNYSE TAGNNNTHHQ DTGEESASSG KLGLITNTIA GVAGLITGGR RTRREVIVNA QPKCNPNLHY WTTQDEGAAI GLAWIPYFGP AAEGI YTEG LMHNQDGLIC GLRQLANETT QALQLFLRAT TELRTFSILN RKAIDFLLQR WGGTCHILGP DCCIEPHDWT KNITDKIDQI I HDFVD. It is sometimes possible for the material contained within the vial of "GP Protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.