Pre-glycoprotein polyprotein GP complex (GPC) Recombinant Protein | GPC recombinant protein
Recombinant Lymphocytic choriomeningitis virus Pre-glycoprotein polyprotein GP complex (GPC), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pre-glycoprotein polyprotein GP complex (GPC); N/A; Recombinant Lymphocytic choriomeningitis virus Pre-glycoprotein polyprotein GP complex (GPC), partial; Stable signal peptide; SSP; Glycoprotein G1; GP1; Glycoprotein G2; GP2; GPC recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
266-498aa; Partial
Sequence
GTFTWTLSDSSGVENPGGYCLTKWMILAAELKCFGNTAVAKCNVNHDAEFCDMLRLIDYNKAALSKFKEDVESALHLFKTTVNSLISDQLLMRNHLRDLMGVPYCNYSKFWYLEHAKTGETSVPKCWLVTNGSYLNETHFSDQIEQEADNMITEMLRKDYIKRQGSTPLALMDLLMFSTSAYLVSIFLHLVKIPTHRHIKGGSCPKPHRLTNKGICSCGAFKVPGVKTVWKRR
Species
Lymphocytic choriomeningitis virus (strain Armstrong) (LCMV)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for GPC recombinant protein
Stable signal peptide (SSP) is cleaved but is apparently retained as the third component of the GP complex. The SSP is required for efficient glycoprotein expression, post-translational cleavage of GP1 and GP2, glycoprotein transport to the cell plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion.
Product Categories/Family for GPC recombinant protein
References
"Molecular characterization of the genomic S RNA segment from lymphocytic choriomeningitis virus."
Southern P.J., Singh M.K., Riviere Y., Jacoby D.R., Buchmeier M.J., Oldstone M.B.A.
Virology 157:145-155(1987)
NCBI and Uniprot Product Information
NCBI GI #
Molecular Weight
42.4 kDa
NCBI Official Full Name
Pre-glycoprotein polyprotein GP complex
UniProt Protein Name
Pre-glycoprotein polyprotein GP complex
UniProt Gene Name
GPC
UniProt Synonym Gene Names
GP-C; SSP; GP1; GP2
UniProt Entry Name
GLYC_LYCVA
Similar Products
Product Notes
The GPC gpc (Catalog #AAA18656) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 266-498aa; Partial. The amino acid sequence is listed below: GTFTWTLSDS SGVENPGGYC LTKWMILAAE LKCFGNTAVA KCNVNHDAEF CDMLRLIDYN KAALSKFKED VESALHLFKT TVNSLISDQL LMRNHLRDLM GVPYCNYSKF WYLEHAKTGE TSVPKCWLVT NGSYLNETHF SDQIEQEADN MITEMLRKDY IKRQGSTPLA LMDLLMFSTS AYLVSIFLHL VKIPTHRHIK GGSCPKPHRL TNKGICSCGA FKVPGVKTVW KRR. It is sometimes possible for the material contained within the vial of "Pre-glycoprotein polyprotein GP complex (GPC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.