Probable G-protein coupled receptor 157 (GPR157) Recombinant Protein | GPR157 recombinant protein
Recombinant Human Probable G-protein coupled receptor 157 (GPR157)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable G-protein coupled receptor 157 (GPR157); N/A; Recombinant Human Probable G-protein coupled receptor 157 (GPR157); GPR157 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-335aa; full length protein
Sequence
MQPSPPPTELVPSERAVVLLSCALSALGSGLLVATHALWPDLRSRARRLLLFLSLADLLSAASYFYGVLQNFAGPSWDCVLQGALSTFANTSSFFWTVAIALYLYLSIVRAARGPRTDRLLWAFHVVSWGVPLVITVAAVALKKIGYDASDVSVGWCWIDLEAKDHVLWMLLTGKLWEMLAYVLLPLLYLLVRKHINRAHTALSEYRPILSQEHRLLRHSSMADKKLVLIPLIFIGLRVWSTVRFVLTLCGSPAVQTPVLVVLHGIGNTFQGGANCIMFVLCTRAVRTRLFSLCCCCCSSQPPTKSPAGTPKAPAPSKPGESQESQGTPGELPST
Sequence Length
Full length protein
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for GPR157 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
39.4 kDa
NCBI Official Full Name
probable G-protein coupled receptor 157
NCBI Official Synonym Full Names
G protein-coupled receptor 157
NCBI Official Symbol
GPR157
NCBI Protein Information
probable G-protein coupled receptor 157
UniProt Protein Name
Probable G-protein coupled receptor 157
UniProt Gene Name
GPR157
UniProt Entry Name
GP157_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The GPR157 gpr157 (Catalog #AAA230656) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-335aa; full length protein. The amino acid sequence is listed below: MQPSPPPTEL VPSERAVVLL SCALSALGSG LLVATHALWP DLRSRARRLL LFLSLADLLS AASYFYGVLQ NFAGPSWDCV LQGALSTFAN TSSFFWTVAI ALYLYLSIVR AARGPRTDRL LWAFHVVSWG VPLVITVAAV ALKKIGYDAS DVSVGWCWID LEAKDHVLWM LLTGKLWEML AYVLLPLLYL LVRKHINRAH TALSEYRPIL SQEHRLLRHS SMADKKLVLI PLIFIGLRVW STVRFVLTLC GSPAVQTPVL VVLHGIGNTF QGGANCIMFV LCTRAVRTRL FSLCCCCCSS QPPTKSPAGT PKAPAPSKPG ESQESQGTPG ELPST. It is sometimes possible for the material contained within the vial of "Probable G-protein coupled receptor 157 (GPR157), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.