Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA279400_AD13.jpg Application Data (Detected by Mouse anti-6*His monoclonal antibody.(This tag can be tested only under denaturing conditions.))

G-protein coupled receptor 20 (GPR20)-VLPs Recombinant Protein | GPR20 recombinant protein

Recombinant Human G-protein coupled receptor 20 (GPR20)-VLPs (Active)

Average rating 0.0
No ratings yet
Purity
The purity information is not available for VLPs proteins.
Synonyms
G-protein coupled receptor 20 (GPR20)-VLPs; N/A; Recombinant Human G-protein coupled receptor 20 (GPR20)-VLPs (Active); GPR20 Human-VLPs; GPR20 recombinant protein
Ordering
Host
Mammalian cell
Purity/Purification
The purity information is not available for VLPs proteins.
Form/Format
Lyophilized powder. Lyophilized from a 0.2um sterile filtered PBS, 6% Trehalose, pH 7.4
Sequence
MPSVSPAGPSAGAVPNATAVTTVRTNASGLEVPLFHLFARLDEELHGTFPGLWLALMAVHGAIFLAGLVLNGLALYVFCCRTRAKTPSVIYTINLVVTDLLVGLSLPTRFAVYYGARGCLRCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVRPEGSRRCRQPACARAVCAFVWLAAGAVTLSVLGVTGSRPCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLHQGRQRRVRAMQLLLTVLIIFLVCFTPFHARQVAVALWPDMPHHTSLVVYHVAVTLSSLNSCMDPIVYCFVTSGFQATVRGLFGQHGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGPEA
Sequence Length
1-358aa; Full Length
Species
Homo sapiens (Human)
Tag
C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
Transmembrane Domain
7TM
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80 degree C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human GPR20 at 10ug/mL can bind Anti-GPR20 recombinant antibody. The EC50 is 2.431-3.239ng/mL.The VLPs is negative control.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Notes: The VLPs are expressed from human 293 cells (HEK293). Mix the sample gently by repeatedly pipetting it up and down. Do not vortex. Repeated freezing and thawing is not recommended. Store the protein at -20 degree C/-80 degree C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).

Application Data

(Detected by Mouse anti-6*His monoclonal antibody.(This tag can be tested only under denaturing conditions.))

product-image-AAA279400_AD13.jpg Application Data (Detected by Mouse anti-6*His monoclonal antibody.(This tag can be tested only under denaturing conditions.))

Bioactivity

product-image-AAA279400_BIOACTIVITY15.jpg Bioactivity
Related Product Information for GPR20 recombinant protein
Orphan receptor with constitutive G(i) signaling activity that activate cyclic AMP.
Product Categories/Family for GPR20 recombinant protein
References
Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.Feldman D.S., Zamah A.M., Pierce K.L., Miller W.E., Kelly F., Rapacciuolo A., Rockman H.A., Koch W.J., Luttrell L.M.J Biol Chem 277:28631-28640 (2002)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,650 Da
NCBI Official Full Name
G-protein coupled receptor 20
NCBI Official Synonym Full Names
G protein-coupled receptor 20
NCBI Official Symbol
GPR20
NCBI Protein Information
G-protein coupled receptor 20
UniProt Protein Name
G-protein coupled receptor 20
UniProt Gene Name
GPR20
UniProt Entry Name
GPR20_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The GPR20 gpr20 (Catalog #AAA279400) is a Recombinant Protein produced from Mammalian cell and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MPSVSPAGPS AGAVPNATAV TTVRTNASGL EVPLFHLFAR LDEELHGTFP GLWLALMAVH GAIFLAGLVL NGLALYVFCC RTRAKTPSVI YTINLVVTDL LVGLSLPTRF AVYYGARGCL RCAFPHVLGY FLNMHCSILF LTCICVDRYL AIVRPEGSRR CRQPACARAV CAFVWLAAGA VTLSVLGVTG SRPCCRVFAL TVLEFLLPLL VISVFTGRIM CALSRPGLLH QGRQRRVRAM QLLLTVLIIF LVCFTPFHAR QVAVALWPDM PHHTSLVVYH VAVTLSSLNS CMDPIVYCFV TSGFQATVRG LFGQHGEREP SSGDVVSMHR SSKGSGRHHI LSAGPHALTQ ALANGPEA. It is sometimes possible for the material contained within the vial of "G-protein coupled receptor 20 (GPR20)-VLPs, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.