G-protein coupled receptor 20 (GPR20)-VLPs Recombinant Protein | GPR20 recombinant protein

Recombinant Human G-protein coupled receptor 20 (GPR20)-VLPs (Active)

Cat. Num. AAA279400

• Purity: The purity information is not available for VLPs proteins.
• Synonyms: G-protein coupled receptor 20 (GPR20)-VLPs; N/A; Recombinant Human G-protein coupled receptor 20 (GPR20)-VLPs (Active); GPR20 Human-VLPs; GPR20 recombinant protein

• Host: Mammalian cell
• Purity/Purification: The purity information is not available for VLPs proteins.
• Form/Format: Lyophilized powder. Lyophilized from a 0.2um sterile filtered PBS, 6% Trehalose, pH 7.4
• Sequence: MPSVSPAGPSAGAVPNATAVTTVRTNASGLEVPLFHLFARLDEELHGTFPGLWLALMAVHGAIFLAGLVLNGLALYVFCCRTRAKTPSVIYTINLVVTDLLVGLSLPTRFAVYYGARGCLRCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVRPEGSRRCRQPACARAVCAFVWLAAGAVTLSVLGVTGSRPCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLHQGRQRRVRAMQLLLTVLIIFLVCFTPFHARQVAVALWPDMPHHTSLVVYHVAVTLSSLNSCMDPIVYCFVTSGFQATVRGLFGQHGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGPEA
• Sequence Length: 1-358aa; Full Length

• Species: Homo sapiens (Human)
• Tag: C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
• Transmembrane Domain: 7TM
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80 degree C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human GPR20 at 10ug/mL can bind Anti-GPR20 recombinant antibody. The EC50 is 2.431-3.239ng/mL.The VLPs is negative control.
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.; Notes: The VLPs are expressed from human 293 cells (HEK293). Mix the sample gently by repeatedly pipetting it up and down. Do not vortex. Repeated freezing and thawing is not recommended. Store the protein at -20 degree C/-80 degree C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).

Application Data

(Detected by Mouse anti-6*His monoclonal antibody.(This tag can be tested only under denaturing conditions.))

Bioactivity

Related Product Information for GPR20 recombinant protein

Orphan receptor with constitutive G(i) signaling activity that activate cyclic AMP.

Product Categories/Family for GPR20 recombinant protein

Signal Transduction

References

Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.Feldman D.S., Zamah A.M., Pierce K.L., Miller W.E., Kelly F., Rapacciuolo A., Rockman H.A., Koch W.J., Luttrell L.M.J Biol Chem 277:28631-28640 (2002)

NCBI and Uniprot Product Information

• NCBI GI #: 89257346
• NCBI GeneID: 2843
• NCBI Accession #: NP_005284.2
• NCBI GenBank Nucleotide #: NM_005293.2
• UniProt Accession #: Q99678; Q17R96
• Molecular Weight: 38,650 Da
• NCBI Official Full Name: G-protein coupled receptor 20
• NCBI Official Synonym Full Names: G protein-coupled receptor 20
• NCBI Official Symbol: GPR20
• NCBI Protein Information: G-protein coupled receptor 20
• UniProt Protein Name: G-protein coupled receptor 20
• UniProt Gene Name: GPR20
• UniProt Entry Name: GPR20_HUMAN