Glutamate [NMDA] receptor subunit epsilon-1 Recombinant Protein | GRIN2A recombinant protein

Recombinant Human Glutamate [NMDA] receptor subunit epsilon-1

Cat. Num. AAA116135

• Gene Names: GRIN2A; LKS; EPND; FESD; NR2A; GluN2A; NMDAR2A
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Glutamate [NMDA] receptor subunit epsilon-1; N/A; Recombinant Human Glutamate [NMDA] receptor subunit epsilon-1; N-methyl D-aspartate receptor subtype 2A; NMDAR2A; NR2A; hNR2A; GRIN2A recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 501-550aa & 601-630aa & 701-750aa; Partial
• Sequence: VYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTI

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for GRIN2A recombinant protein

NMDA receptor subtype of glutamate-gated ion channels possesses high calcium permeability and voltage-dependent sensitivity to magnesium. Activation requires binding of agonist to both types of subunits.

Product Categories/Family for GRIN2A recombinant protein

Transport

References

Human N-methyl-D-aspartate receptor modulatory subunit hNR2A cloning and sequencing of the cDNA and primary structure of the protein.Foldes R.L., Adams S.L., Fantaske R.P., Kamboj R.K.Biochim. Biophys. Acta 1223:155-159(1994) Cloning and functional characterization of human heteromeric N-methyl-D-aspartate receptors.Hess S.D., Daggett L.P., Crona J., Deal C., Lu C.-C., Urrutia A., Chavez-Noriega L., Ellis S.B., Johnson E.C., Velicelebi G.J. Pharmacol. Exp. Ther. 278:808-816(1996) The sequence and analysis of duplication-rich human chromosome 16.Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J., Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.Nature 432:988-994(2004) Mutations in GRIN2A and GRIN2B encoding regulatory subunits of NMDA receptors cause variable neurodevelopmental phenotypes.Endele S., Rosenberger G., Geider K., Popp B., Tamer C., Stefanova I., Milh M., Kortum F., Fritsch A., Pientka F.K., Hellenbroich Y., Kalscheuer V.M., Kohlhase J., Moog U., Rappold G., Rauch A., Ropers H.H., von Spiczak S., Tonnies H., Villeneuve N., Villard L., Zabel B., Zenker M., Laube B., Reis A., Wieczorek D., Van Maldergem L., Kutsche K.Nat. Genet. 42:1021-1026(2010) Exome sequencing identifies GRIN2A as frequently mutated in melanoma.Wei X., Walia V., Lin J.C., Teer J.K., Prickett T.D., Gartner J., Davis S., Stemke-Hale K., Davies M.A., Gershenwald J.E., Robinson W., Robinson S., Rosenberg S.A., Samuels Y.Nat. Genet. 43:442-446(2011) Diagnostic exome sequencing in persons with severe intellectual disability.de Ligt J., Willemsen M.H., van Bon B.W., Kleefstra T., Yntema H.G., Kroes T., Vulto-van Silfhout A.T., Koolen D.A., de Vries P., Gilissen C., del Rosario M., Hoischen A., Scheffer H., de Vries B.B., Brunner H.G., Veltman J.A., Vissers L.E.N. Engl. J. Med. 367:1921-1929(2012) GRIN2A mutations in acquired epileptic aphasia and related childhood focal epilepsies and encephalopathies with speech and language dysfunction.Lesca G., Rudolf G., Bruneau N., Lozovaya N., Labalme A., Boutry-Kryza N., Salmi M., Tsintsadze T., Addis L., Motte J., Wright S., Tsintsadze V., Michel A., Doummar D., Lascelles K., Strug L., Waters P., de Bellescize J., Vrielynck P., de Saint Martin A., Ville D., Ryvlin P., Arzimanoglou A., Hirsch E., Vincent A., Pal D., Burnashev N., Sanlaville D., Szepetowski P.Nat. Genet. 45:1061-1066(2013) Mutations in GRIN2A cause idiopathic focal epilepsy with rolandic spikes.Lemke J.R., Lal D., Reinthaler E.M., Steiner I., Nothnagel M., Alber M., Geider K., Laube B., Schwake M., Finsterwalder K., Franke A., Schilhabel M., Jahn J.A., Muhle H., Boor R., Van Paesschen W., Caraballo R., Fejerman N., Weckhuysen S., De Jonghe P., Larsen J., Moller R.S., Hjalgrim H., Addis L., Tang S., Hughes E., Pal D.K., Veri K., Vaher U., Talvik T., Dimova P., Guerrero Lopez R., Serratosa J.M., Linnankivi T., Lehesjoki A.E., Ruf S., Wolff M., Buerki S., Wohlrab G., Kroell J., Datta A.N., Fiedler B., Kurlemann G., Kluger G., Hahn A., Haberlandt D.E., Kutzer C., Sperner J., Becker F., Weber Y.G., Feucht M., Steinbock H., Neophythou B., Ronen G.M., Gruber-Sedlmayr U., Geldner J., Harvey R.J., Hoffmann P., Herms S., Altmuller J., Toliat M.R., Thiele H., Nurnberg P., Wilhelm C., Stephani U., Helbig I., Lerche H., Zimprich F., Neubauer B.A., Biskup S., von Spiczak S.Nat. Genet. 45:1067-1072(2013) GRIN2A mutations cause epilepsy-aphasia spectrum disorders.Carvill G.L., Regan B.M., Yendle S.C., O'Roak B.J., Lozovaya N., Bruneau N., Burnashev N., Khan A., Cook J., Geraghty E., Sadleir L.G., Turner S.J., Tsai M.H., Webster R., Ouvrier R., Damiano J.A., Berkovic S.F., Shendure J., Hildebrand M.S., Szepetowski P., Scheffer I.E., Mefford H.C.Nat. Genet. 45:1073-1076(2013) Evidence that GRIN2A mutations in melanoma correlate with decreased survival.D'mello S.A., Flanagan J.U., Green T.N., Leung E.Y., Askarian-Amiri M.E., Joseph W.R., McCrystal M.R., Isaacs R.J., Shaw J.H., Furneaux C.E., During M.J., Finlay G.J., Baguley B.C., Kalev-Zylinska M.L.Front. Oncol. 3:333-333(2014) Whole-exome sequencing in an individual with severe global developmental delay and intractable epilepsy identifies a novel, de novo GRIN2A mutation.FORGE Canada ConsortiumVenkateswaran S., Myers K.A., Smith A.C., Beaulieu C.L., Schwartzentruber J.A., Majewski J., Bulman D., Boycott K.M., Dyment D.A.Epilepsia 55:E75-E79(2014) Functional analysis of a de novo GRIN2A missense mutation associated with early-onset epileptic encephalopathy.Yuan H., Hansen K.B., Zhang J., Pierson T.M., Markello T.C., Fajardo K.V., Holloman C.M., Golas G., Adams D.R., Boerkoel C.F., Gahl W.A., Traynelis S.F.Nat. Commun. 5:3251-3251(2014)

NCBI and Uniprot Product Information

• NCBI GI #: 4504125
• NCBI GeneID: 2903
• NCBI Accession #: NP_000824.1
• NCBI GenBank Nucleotide #: NM_000833.4
• UniProt Accession #: Q12879; O00669; Q17RZ6
• Molecular Weight: 18.2 kDa
• NCBI Official Full Name: glutamate receptor ionotropic, NMDA 2A isoform 1
• NCBI Official Synonym Full Names: glutamate ionotropic receptor NMDA type subunit 2A
• NCBI Official Symbol: GRIN2A
• NCBI Official Synonym Symbols: LKS; EPND; FESD; NR2A; GluN2A; NMDAR2A
• NCBI Protein Information: glutamate receptor ionotropic, NMDA 2A
• UniProt Protein Name: Glutamate receptor ionotropic, NMDA 2A
• UniProt Gene Name: GRIN2A
• UniProt Synonym Gene Names: NMDAR2A; GluN2A; NMDAR2A; NR2A; hNR2A
• UniProt Entry Name: NMDE1_HUMAN