Gastrin-releasing peptide Recombinant Protein | GRP recombinant protein
Recombinant Human Gastrin-releasing peptide
Gene Names
GRP; BN; GRP-10; proGRP; preproGRP
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Gastrin-releasing peptide; N/A; Recombinant Human Gastrin-releasing peptide; GRP-10; GRP recombinant protein
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
54-121
Sequence
STGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKD
Sequence Length
121
Product Note
Applications are user defined. Product is developed and quality control tested in house, data or additional information may be provided upon request. The researcher needs to establish and confirm the suitability of the product for their application.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for GRP recombinant protein
GRP stimulates gastrin release as well as other gastrointestinal hormones. Operates as a negative feedback regulating fear and established a causal relationship between GRP-receptor gene expression, long-term potentiation, and amygdala-dependent mory for fear.
Product Categories/Family for GRP recombinant protein
References
Two prohormones for gastrin-releasing peptide are encoded by two mRNAs differing by 19 nucleotides.Spindel E.R., Zilberberg M.D., Habener J.F., Chin W.W.Proc. Natl. Acad. Sci. U.S.A. 83:19-23(1986)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35.1kD
NCBI Official Full Name
gastrin-releasing peptide isoform 2
NCBI Official Synonym Full Names
gastrin releasing peptide
NCBI Official Symbol
GRP
NCBI Official Synonym Symbols
BN; GRP-10; proGRP; preproGRP
NCBI Protein Information
gastrin-releasing peptide
UniProt Protein Name
Gastrin-releasing peptide
UniProt Gene Name
GRP
UniProt Synonym Gene Names
GRP
UniProt Entry Name
GRP_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The GRP grp (Catalog #AAA113219) is a Recombinant Protein and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 54-121. The amino acid sequence is listed below: STGESSSVSE RGSLKQQLRE YIRWEEAARN LLGLIEAKEN RNHQPPQPKA LGNQQPSWDS EDSSNFKD. It is sometimes possible for the material contained within the vial of "Gastrin-releasing peptide, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
