Guanylate cyclase activator 2B Recombinant Protein | Guca2b recombinant protein
Recombinant Mouse Guanylate cyclase activator 2B
Gene Names
Guca2b; Ugn; Gcap2; AV066530
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Guanylate cyclase activator 2B; N/A; Recombinant Mouse Guanylate cyclase activator 2B; Guca2b recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-106aa; Full Length
Sequence
VYIKYHGFQVQLESVKKLNELEEKEMSNPQPRRSGLLPAVCHNPALPLDLQPVCASQEAASTFKALRTIATDECELCINVACTGC
Sequence Length
106
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for Guca2b recombinant protein
Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport.
References
Uroguanylin and guanylin distinct but overlapping patterns of messenger RNA expression in mouse intestine.Whitaker T.L., Witte D.P., Scott M.C., Cohen M.B.Gastroenterology 113:1000-1006(1997) Sanford L.P., Cohen M.B.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11.4 kDa
NCBI Official Full Name
guanylate cyclase activator 2B preproprotein
NCBI Official Synonym Full Names
guanylate cyclase activator 2b (retina)
NCBI Official Symbol
Guca2b
NCBI Official Synonym Symbols
Ugn; Gcap2; AV066530
NCBI Protein Information
guanylate cyclase activator 2B
UniProt Protein Name
Guanylate cyclase activator 2B
UniProt Gene Name
Guca2b
UniProt Synonym Gene Names
UGN
UniProt Entry Name
GUC2B_MOUSE
Similar Products
Product Notes
The Guca2b guca2b (Catalog #AAA115565) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-106aa; Full Length. The amino acid sequence is listed below: VYIKYHGFQV QLESVKKLNE LEEKEMSNPQ PRRSGLLPAV CHNPALPLDL QPVCASQEAA STFKALRTIA TDECELCINV ACTGC. It is sometimes possible for the material contained within the vial of "Guanylate cyclase activator 2B, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
