Granzyme B Recombinant Protein | GZMB recombinant protein

Recombinant Human Granzyme B (GZMB)

Cat. Num. AAA114085

• Gene Names: GZMB; HLP; CCPI; CGL1; CSPB; SECT; CGL-1; CSP-B; CTLA1; CTSGL1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Granzyme B; N/A; Recombinant Human Granzyme B (GZMB); C11; CTLA-1; Cathepsin G-like 1; CTSGL1; Cytotoxic T-lymphocyte proteinase 2; Lymphocyte protease; Fragmentin-2; Granzyme-2; Human lymphocyte protein; HLP; SECT; T-cell serine protease 1-3E; GZMB recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 21-247aa; Full Length of Mature Protein
• Sequence: IIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for GZMB recombinant protein

This enzyme is necessary for target cell lysis in cell-mediated immune responses. It cleaves after Asp. Ses to be linked to an activation cascade of caspases (aspartate-specific cysteine proteases) responsible for apoptosis execution. Cleaves caspase-3, -7, -9 and 10 to give rise to active enzymes mediating apoptosis.

Product Categories/Family for GZMB recombinant protein

Immunology

References

Induction of mRNA for a serine protease and a beta-thromboglobulin-like protein in mitogen-stimulated human leukocytes.Schmid J., Weissmann C.J. Immunol. 139:250-256(1987) Structure and differential mechanisms of regulation of expression of a serine esterase gene in activated human T lymphocytes.Caputo A., Fahey D., Lloyd C., Vozab R., McCairns E., Rowe P.B.J. Biol. Chem. 263:6363-6369(1988) Molecular cloning of an inducible serine esterase gene from human cytotoxic lymphocytes.Trapani J.A., Klein J.L., White P.C., Dupont B.Proc. Natl. Acad. Sci. U.S.A. 85:6924-6928(1988) Genomic organization and chromosomal assignment for a serine protease gene (CSPB) expressed by human cytotoxic lymphocytes.Klein J.L., Shows T.B., Dupont B., Trapani J.A.Genomics 5:110-117(1989) Nucleotide sequence and genomic organization of a human T lymphocyte serine protease gene.Caputo A., Sauer D.E., Rowe P.B.J. Immunol. 145:737-744(1990) Structural organization of the hCTLA-1 gene encoding human granzyme B.Haddad P., Clement M.-V., Bernard O., Larsen C.-J., Degos L., Sasportes M., Mathieu-Mahul D.Gene 87:265-271(1990) The DNA sequence and analysis of human chromosome 14.Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H., Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.Nature 421:601-607(2003) Isolation of a cDNA clone encoding a novel form of granzyme B from human NK cells and mapping to chromosome 14.Dahl C.A., Bach F.H., Chan W., Huebner K., Russo G., Croce C.M., Herfurth T., Cairns J.S.Hum. Genet. 84:465-470(1990) Characterization of three serine esterases isolated from human IL-2 activated killer cells.Hameed A., Lowrey D.M., Lichtenheld M., Podack E.R.J. Immunol. 141:3142-3147(1988) Characterization of granzymes A and B isolated from granules of cloned human cytotoxic T lymphocytes.Kraehenbuhl O., Rey C., Jenne D.E., Lanzavecchia A., Groscurth P., Carrel S., Tschopp J.J. Immunol. 141:3471-3477(1988) Human granzyme B degrades aggrecan proteoglycan in matrix synthesized by chondrocytes.Froelich C.J., Zhang X., Turbov J., Hudig D., Winkler U., Hanna W.L.J. Immunol. 151:7161-7171(1993) Human cytotoxic lymphocyte granzyme B. Its purification from granules and the characterization of substrate and inhibitor specificity.Poe M., Blake J.T., Boulton D.A., Gammon M., Sigal N.H., Wu J.K., Zweerink H.J.J. Biol. Chem. 266:98-103(1991) Signal peptide prediction based on analysis of experimentally verified cleavage sites.Zhang Z., Henzel W.J.Protein Sci. 13:2819-2824(2004) Crystal structure of the caspase activator human granzyme B, a proteinase highly specific for an Asp-P1 residue.Estebanez-Perpina E., Fuentes-Prior P., Belorgey D., Braun M., Kiefersauer R., Maskos K., Huber R., Rubin H., Bode W.Biol. Chem. 381:1203-1214(2000) The three-dimensional structure of human granzyme B compared to caspase-3, key mediators of cell death with cleavage specificity for aspartic acid in P1.Rotonda J., Garcia-Calvo M., Bull H.G., Geissler W.M., McKeever B.M., Willoughby C.A., Thornberry N.A., Becker J.W.Chem. Biol. 8:357-368(2001) Catalog of 680 variations among eight cytochrome p450 (CYP) genes, nine esterase genes, and two other genes in the Japanese population.Saito S., Iida A., Sekine A., Kawauchi S., Higuchi S., Ogawa C., Nakamura Y.J. Hum. Genet. 48:249-270(2003)

NCBI and Uniprot Product Information

• NCBI GI #: 221625528
• NCBI GeneID: 3002
• NCBI Accession #: NP_004122.2
• NCBI GenBank Nucleotide #: NM_004131.4
• UniProt Accession #: P10144; Q8N1D2; Q9UCC1
• Molecular Weight: 27.5 kDa
• NCBI Official Full Name: granzyme B
• NCBI Official Synonym Full Names: granzyme B
• NCBI Official Symbol: GZMB
• NCBI Official Synonym Symbols: HLP; CCPI; CGL1; CSPB; SECT; CGL-1; CSP-B; CTLA1; CTSGL1
• NCBI Protein Information: granzyme B
• UniProt Protein Name: Granzyme B
• UniProt Gene Name: GZMB
• UniProt Synonym Gene Names: CGL1; CSPB; CTLA1; GRB; CTSGL1; Lymphocyte protease; HLP
• UniProt Entry Name: GRAB_HUMAN